KEGG   Columba livia (rock pigeon): 102092425
Entry
102092425         CDS       T02912                                 

Gene name
ADCY3
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00230  Purine metabolism
clv01100  Metabolic pathways
clv04020  Calcium signaling pathway
clv04114  Oocyte meiosis
clv04261  Adrenergic signaling in cardiomyocytes
clv04270  Vascular smooth muscle contraction
clv04371  Apelin signaling pathway
clv04540  Gap junction
clv04912  GnRH signaling pathway
clv04914  Progesterone-mediated oocyte maturation
clv04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102092425 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102092425 (ADCY3)
   04020 Calcium signaling pathway
    102092425 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102092425 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102092425 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102092425 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102092425 (ADCY3)
   04916 Melanogenesis
    102092425 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102092425 (ADCY3)
   04270 Vascular smooth muscle contraction
    102092425 (ADCY3)
Enzymes [BR:clv01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102092425 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N fn3_4
Other DBs
NCBI-GeneID: 102092425
NCBI-ProteinID: XP_021154196
LinkDB
Position
Unknown
AA seq 1074 aa
MPRNRDFSEPECSAEYSADYSVSLPSDPEHGVGRTHEVTVRSSGPCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVLIMCAVVYSADKLAPVLAAVAGLVAHVL
LFILCXXXXXXFLPYVLWVLILAQIFCYLGLNFSRSPEASDTVGWQAFFVFSFFITLPLR
LAPIVLITAVSCGIHTLVLGVTVAQQQQDALDEGTLLRQESQLRFSHRCPQERLMLSILP
KHVADEMLKDMKKDPSQKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLL
NELFARFDKLAAKHHQLRIKILGDCYYCICGLPEYREDHAVCSIMMGLAMVEAISYVREK
TKTAVDMRVGVHSGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCL
KGEFEVEPGEGGTRCEYLKEKGIVTYLVVVPKQPLRNGINGVKLSLTSSHGGSPPLVNTK
ELNGSLSPEESEEPDARVRGTLESGEEDGEAVNPSFPNPRRRLRLRDLAERVMDASQNEQ
ELNKLLNEALLERESIQALKGKSTFRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLF
FTALVEVFIDPWLVANYVTFVVGEVLLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWA
RNTWAMAAIIIVTMADIVDMLSCWQDHGGTSNMTMGPPWPGGCREQPKYYSYIALLALVA
TIMLVQVSHMVKLTLMVLITGATGTVNIYAWEYIFDQYDRRRGQQSVSSLVPSKYSMTAM
IFIVMLSFYYFSRHVEKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFL
GSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDE
PQFRCITKIKTIGSTYMAASGVTPDANTNGYSTKKETLSDKERWQHLADLADFALAMKVT
LMNINYQSFNNFMLRIGMNKGAVLAGGVRYYDIWGNTVNVASRMESTGVMGNIQVVEETH
LILKEYGFRFVRRGAIYVKGKGELLTFFLKGREKQGSFLNGSSVTLLHQVVDSS
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgcccaggaacagggatttttcggagcccgagtgctcggccgagtactccgccgactac
tcggtgagcctgccgtcggaccccgagcacggcgtgggtcggacccacgaggtgacggtg
cgcagctcgggcccctgcctctgcctgccccgcttcatgcgcctcaccttcgctcccgag
tctctggagaacctctaccagacttatttccgccgtcaacgccacgaaaccctcctggtg
ctggtggtcttcgccgccctcttcgactgctacgtcctcatcatgtgcgccgtggtttac
agcgccgataaactggccccggtgctggcggcggtggccgggctggtcgcccacgtcttg
ctcttcatcctctgcnnnnnnnnnnnnnnnnngttcctgccttatgtcctctgggtcctc
atcttggcccaaatcttctgctacttggggctcaacttctcccgctcgcccgaggccagc
gacacggtgggttggcaagcgttcttcgtcttctccttcttcatcaccctgccgctgcgc
ctggcgcccatcgtgctcatcaccgccgtctcttgcggcatccacacgctggtgctcggt
gtcactgtcgcccagcagcagcaggacgccctggacgaggggacgctgctgagacaggaa
tcacaactgcgtttctcgcaccgctgtccgcaggagcggctgatgctctccatcctgccc
aagcacgtggccgacgagatgctgaaggacatgaagaaagacccgagccagaaggagatg
caacagttcaacaccatgtacatgtaccgccacgagaacgtcagcatcctcttcgccgac
atcgtgggcttcacccagctctcctcgtcctgcagcgcccaggagctggtgaagctcctc
aacgagctcttcgcccgcttcgacaagttggcagctaaacaccaccagctgcgcatcaag
atcctgggtgactgttactactgcatctgcgggctgcccgagtaccgggaggaccacgcc
gtctgctccatcatgatgggcttggccatggtggaggccatctcctacgtgcgggagaag
accaagacggcggtggacatgcgggtgggggtgcacagcgggacggtgctggggggggtg
ctgggccagaagcgctggcagtacgacgtgtggtccaccgatgtcaccgtggccaacaag
atggaggcaggtggcatccccgggcgggtgcacatctcgcagagcaccatggattgcctg
aagggcgagtttgaggtggaaccgggagaaggtggcacccgctgcgagtacctgaaggag
aagggcatcgtcacctacctcgtggtggtccccaagcagcccctgcgcaacggcatcaac
ggcgtgaagctgtcgctgacctcttcccatggtggttccccaccgttggtcaacaccaag
gaactcaacggcagcctcagccctgaggagtccgaggagcctgatgccagggtgaggggc
accctggagagcggggaggaggatggcgaggcggtgaacccctccttccccaaccctcgg
cggcggctgcgcctgcgggacctggccgagcgggtgatggacgcctcacagaacgagcag
gagctcaacaagctactcaacgaagctttgctggagcgcgagtccatccaggcgctgaag
gggaagagcaccttccggctctccatgcgcttcatcgaccccgaaatggagacgcgctac
tcggtggagaaggagaagcagagcggagctgccttcagctgctcttgcgttgtccttttc
ttcaccgccttggtggaggtcttcatcgacccctggttggtggccaactacgtgaccttt
gtggtgggggaggtcctactgctcatcctcaccctctgctccttggctgccatcttcccc
cgggtcttccccaaaaaactcgtggccttctccacctggattgacagaacccgctgggca
cgcaacacctgggccatggccgccatcatcatcgtcaccatggccgacattgtggacatg
ctcagctgctggcaggaccatggtgggacaagcaacatgacgatggggccaccgtggcca
ggtggctgcagggagcagcccaagtactacagctacattgcgctgctggccttggtggcc
accatcatgctggtgcaggtcagccacatggtcaagctgaccctcatggtgctcatcacc
ggggccactggcaccgtcaacatctacgcctgggagtatatctttgaccagtacgaccgc
cgccgcggccagcaaagcgtgtcctcactggtcccctccaagtactccatgacggcgatg
atcttcatcgtgatgctcagcttctactacttctctcgccatgtggagaagctggccagg
accctcttcctctggaagatcgatgtccatgaccagaaggagcgggtctacgagatgcgg
cgctggaatgaggcccttgtcaccaacatgctgcccgagcacgtggcccggcacttcctg
ggctccaagaagcgggatgaggagctgtacagccagtcctacgatgagatcggtgtcatg
ttcgcttccctccccaactttgccgacttctacacagaggagagcatcaacaacgggggc
atcgagtgcctgcggttcctcaacgagatcatctccgactttgacgcgctcctggatgaa
ccccagttccggtgcatcaccaaaatcaaaaccatcggcagcacctacatggccgcttct
ggagtgacccccgatgccaacaccaatggctacagcaccaagaaggagaccctctcggat
aaggagcgctggcagcacttggccgacctcgccgacttcgccttggccatgaaggtgacg
ctgatgaacatcaactaccagtccttcaacaacttcatgctccgcataggcatgaacaag
ggggccgtgctggcggggggggtccgttactacgacatctggggcaacacggtgaacgtg
gccagcaggatggagtccaccggtgtgatggggaacatacaggtggtggaggagactcac
ctcatcctgaaggaatacgggttccgcttcgtgcgccggggagccatctacgtcaagggc
aaaggggagctgctcaccttcttcctgaagggccgggagaagcagggctccttcctcaac
ggctcctccgtcaccctgctccaccaggtggtggacagctcctga

DBGET integrated database retrieval system