KEGG   Columba livia (rock pigeon): 102092446Help
Entry
102092446         CDS       T02912                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00052  Galactose metabolism
clv00500  Starch and sucrose metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102092446
   00500 Starch and sucrose metabolism
    102092446
Enzymes [BR:clv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102092446
    3.2.1.20  alpha-glucosidase
     102092446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102092446
NCBI-ProteinID: XP_005515628
LinkDB All DBs
Position
Unknown
AA seq 834 aa AA seqDB search
KNNVARQLKSGEILAIQQNYFMIPQNVLEMNVTHNNYVDPNNLMFEEIKILGLLQEPALI
TVLQNGVQISSHNFTYDPVNKVTVIQGLQLELGKSYSLRWTLGISNNEKFDCDPNPSASE
ENCEQLGCTWEEVTSDFSIPYCYYNGPDNGYSIADVMYASSGVTANVTFTQKDLEESQKS
TSPTSTLRLEVIYHSNHMLQFKIYDYANERYEVPVPINLPTAPESTVENRLYDVVVQDKP
FGIQVRRRNTGTVIWDSQLPTFTFSDMFIQISTRLASQYLYGFGETEHTTFRRDMNWHTW
GMFTRDQPPGYKLNSYGFQPFYMGLEEDGNAHGVLLLNSNAMDVTFQPTPALTYRTTGGI
LDFYMVLGPTPELVVQEYTALVGRPVMPPYWALGFQLCRYGYENDAEIATLVEDMKAAGI
PYDIQYADIDYMERQLDFTLSPHFAGLPALINKIREEGMRFILILDPAISANETNYLAFT
RALEKDVFIKWPNTDDIIYAKVWPDLPNVIVNDSLDWDTQVEIYRAYTAFPDFFRNSTTE
WWTREIAEVYDNPRNASQSLKFDGIWIDMNEPSSFVNGAVGGCRNQELNFPPYMPQLGSR
AEGLAFKTLCMEGQQFLPDGSPVRHYDVHNLYGWSQTKPTLDALRSVTGERGIVVTRSTF
PSSGKWSGHWLGDNTAAWNQLDKSIIGMLEFSLFGISYTGADICGFFGDSEYELCARWME
LGAFYPYSRNHNGEGSKRQDPVAWNSTFEDISRNVLNIRYSLLPYLYTLMYEANARGSTV
VRPLLHEFVDDKLTWEIYKQFLWGPALLISPVLEQGAVVVNAYLPNARWYDYHT
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
aaaaataatgttgctcgccaacttaaatcaggagaaattttggcaattcagcaaaattat
ttcatgattcctcagaacgttctagaaatgaacgtgacgcacaacaactatgtggatccc
aacaacctgatgttcgaagaaatcaagattttgggcttgctccaggaaccagcgttaatc
accgtgttgcagaacggtgtgcagatttcatcacataatttcacctacgatcctgtaaat
aaggttactgtcatacaagggctccagctggaacttggtaaatcatactcattaaggtgg
acactgggaatcagcaataatgagaaattcgattgtgatcccaacccaagtgcatccgag
gaaaactgcgaacagctcggctgcacctgggaagaagtcacctctgattttagcattccc
tactgctactacaacggccccgacaacggttattccattgctgatgtcatgtacgcgtcg
tctggtgtgacggccaatgtcaccttcacgcagaaggacctcgaagagtcccagaaatcc
acgtcacccaccagcaccctgcgcctggaggtgatatatcacagcaaccacatgctgcaa
tttaagatttatgattatgcaaatgaacggtatgaggtgccggttccgataaatctcccc
acggcccccgagagcacagtcgagaatcgactttatgatgtggtggttcaggacaaacca
tttggcatccaggtccgacgccgaaacacagggacggtgatctgggattctcagctcccg
accttcaccttcagtgacatgttcatccagatttcgacacgtttggcttcacagtatctg
tatggatttggtgaaaccgaacacaccacatttcgccgagacatgaactggcacacctgg
gggatgttcaccagggaccaacctcctggatacaagttgaattcttatggtttccagcca
ttctacatgggtcttgaagaagacggcaatgcccacggtgttctcttgcttaacagcaac
gcaatggatgtgaccttccagcccacgcctgctctgacctatcgcacaactggcggaatt
ctggacttttacatggttttggggccgacgccagagcttgttgttcaggaatacaccgca
ctggttgggcggcctgtcatgccaccctactgggcactgggattccagttgtgccgctac
gggtatgaaaatgacgccgaaatcgccacgttggtggaagacatgaaagcagccgggata
ccctatgatatccaatatgcggatattgactatatggaacggcagctggacttcaccctc
agcccgcacttcgccggcttaccagctctaattaacaaaatccgagaagaaggaatgagg
tttatcctgatcctggacccagccatatctgctaacgaaaccaattacctcgccttcaca
agagctttggagaaggacgtcttcatcaaatggcccaatactgatgacatcatatacgca
aaggtgtggccggatcttccgaacgtcatcgttaatgactcactggattgggacacccaa
gtggagatctaccgtgcgtacaccgcttttccagatttcttccgcaattccacgaccgaa
tggtggacgagagaaatcgccgaagtctacgataacccccgcaacgcatcgcaaagcttg
aagttcgacggcatctggatagacatgaacgaaccttcgagcttcgttaatggtgctgtt
ggcggctgcaggaaccaagagctcaactttccaccatatatgccccagctggggtcacgg
gcggagggcttggctttcaagacgctctgcatggaggggcagcaattcctccccgacggt
tcccccgtccgtcactatgacgtccacaacctttacgggtggtcacaaacaaaaccgacc
ctcgacgccttgcggagcgtcacgggggagcgaggaatcgtcgtcacccgctcgaccttc
cccagcagcgggaagtggtcgggacattggctgggggacaacacggctgcctggaaccag
ctggataaatccatcataggcatgttggagtttagtctcttcggaatatcttacacagga
gctgatatctgtggcttcttcggagactcggagtacgagctgtgcgctcggtggatggag
ctcggggccttttacccgtattcaaggaatcacaatggcgaaggatcaaagaggcaagat
cctgttgcctggaattccacatttgaagacatttcaaggaacgtgctgaacatccgatat
tctctcctgccgtatctgtacacgttgatgtacgaagccaacgcccgcggcagcaccgtc
gtccggcccctgctgcacgagtttgtggatgacaaactgacatgggaaatctacaaacaa
tttctgtggggaccagcactgctcatcagccccgtcctggaacagggtgctgtggtggtg
aacgcttacctgcccaatgcccgctggtatgattatcacaca

DBGET integrated database retrieval system