KEGG   Columba livia (rock pigeon): 102092853
Entry
102092853         CDS       T02912                                 

Gene name
BCL2
Definition
(RefSeq) LOW QUALITY PROTEIN: apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04140  Autophagy - animal
clv04141  Protein processing in endoplasmic reticulum
clv04210  Apoptosis
clv04217  Necroptosis
clv04261  Adrenergic signaling in cardiomyocytes
clv04340  Hedgehog signaling pathway
clv04510  Focal adhesion
clv04621  NOD-like receptor signaling pathway
clv05132  Salmonella infection
clv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102092853 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102092853 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102092853 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    102092853 (BCL2)
   04217 Necroptosis
    102092853 (BCL2)
   04115 p53 signaling pathway
    102092853 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102092853 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102092853 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102092853 (BCL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102092853 (BCL2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102092853 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:clv01009]
    102092853 (BCL2)
Protein phosphatases and associated proteins [BR:clv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102092853 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102092853
NCBI-ProteinID: XP_005509790
LinkDB
Position
Unknown
AA seq 222 aa
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPAAAAAAGTSSDHTGL
VSPHPEPPGSAAASHAPPAEGLHPVPQVVHLTLRQAGDEFSRRYQRDFAQMSGQLHLTPF
TASXVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDA
FVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
NT seq 669 nt   +upstreamnt  +downstreamnt
atggctcacccggggagaagaggctacgataaccgggagatagtgctgaagtacatccac
tataaactctcgcagaggggatacgactgggctgccggtgaggacagggctcccctgcct
ccaggtctctctcctgctgctgctgctgctgctgggacttcctctgatcacactgggctg
gtgtctccgcaccccgagccccccggctcggctgctgctagccatgcgcccccggccgag
gggctgcaccccgtgccccaggtcgtccacctcaccctgcgccaggcaggggacgagttc
tcccgtcgctaccagagggactttgcccaaatgtctggccagctgcacctgacgcccttc
acggccagtnttgttaactggggcaggatcgtggccttcttcgagtttggtggtgtgatg
tgcgtggagagcgtcaaccgggagatgtctccccttgtggacagcatcgctgcctggatg
actgagtacctgaaccggcacctgcacaactggatccaggacaacggaggctgggatgcc
ttcgtggagttgtatggcaacagtatgaggcctttgttcgatttctcctggatctctctg
aagactatcctgagtctggttctggtgggagcttgcatcactcttggcgcttatctcgga
cataagtag

DBGET integrated database retrieval system