KEGG   Columba livia (rock pigeon): 102092914
Entry
102092914         CDS       T02912                                 

Gene name
PIDD1
Definition
(RefSeq) p53-induced death domain-containing protein 1 isoform X3
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102092914 (PIDD1)
   04115 p53 signaling pathway
    102092914 (PIDD1)
SSDB
Motif
Pfam: LRR_8 ZU5 Peptidase_S68 LRR_4 Death
Other DBs
NCBI-GeneID: 102092914
NCBI-ProteinID: XP_005509123
UniProt: A0A2I0MIC2
LinkDB
Position
Unknown
AA seq 895 aa
MQKMAELLGLGDECREGTPEAPATAGSCLADNRLNLDVYPDGCRWFLQLFERRRGEVVQV
EFLRLSSNDHLLGTTLGILPHLKHLKSLVLKGGHARDEFGSCQLGSLTSLPPDIGNLRCL
THLDLSFNSLSTLPSCILHLPSLCVLLVSHNSLVALPKNFDSLSKLTFFSAMKNQLKDLP
QSIGELAVLQNLDLSENALEFLPEEVGNLHNCTELDLSGNRLSSIPDSLANLKSLRRLHL
HSNLLVTVPASLASLPNLSRLDLQNNCLRAVPPEIQTSPFVHLRGNPLGETEPSPQADES
SAGELRRLFLPSGEDSFTVTSEGCKVVLACGIRFYFPPGAASDPLQIYFRTLAPDPQCVK
LRHHDVLLSRVLELQPHGVKFQQKVQIWMPYASPQTLHQREVVVRTFSGQNWSDLSTRVK
QKRKSKKHMAHCSVLHFSWFLVVSRLVQNECKVPTEGTLLFSSVDPNIKVTFPPGVTEET
RNVKLQVLPISAEEIEEITADAGCRASPLLCLSQDSLVDFLRPVRIQLPLPPGVTGLNLD
QSRLHLLHGDLEGKTWDDITSQVVLEFTHIYAVFEVTHFSWYWLWYTTKTYVGGIAKKVY
ERLRMYQVNFIALQRKRDPEQVLLQCVPKHKVDPVLKKLQDRYQGPEPSDMVEMFEGEQF
FAAFERGISIDMDRPDCVDGRLSFIFYSHLKNMKEIYVTSPVDRKGQAVKGQVSFYRAAV
PDSIPEDASRRRKGPDSLWLATLPIKLPRLKPRWGENRGPPNGFSFPPLNLGNAETGYLT
QTNLLSIARRVGADWQTIGLNLGLTYQQIERIGYNNREDLDKQILDMLFSWAQQNSEDPD
CVSKLITAMKESGRQDIADEVETIIELGQQKYRESIRRVGLEQESSTEDSATAMM
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgcagaagatggcagagctgctggggctcggggacgagtgcagggaggggactccagag
gctcctgctactgctggctcctgccttgcagacaacagactgaacctggatgtttatcct
gacggctgccgctggttcctccagctgttcgagaggcgacggggagaggtggtccaggtg
gagttcctccgtctcagcagcaacgatcacctccttggcactaccctgggcatccttcct
catctgaagcacctgaaatccctggtgctcaaaggtggccatgccagggatgaatttggt
tcatgtcagcttggctccctgacaagcttgccaccagacattgggaacctgaggtgtctc
acccacctggatctcagcttcaatagtctctccaccttgcccagctgcatcctccacctc
cctagcctctgtgtgctcctggtgagccacaacagcctggtggcactccccaagaacttt
gactctctgagcaagctgactttcttctctgctatgaaaaatcagctgaaggacttacct
cagagcattggggagctggcagtgctgcagaacctggatctctcagaaaatgctttggaa
ttccttcctgaagaagttggaaatctgcacaactgcacagagctggatctctctgggaat
cgcttgtcaagcatcccagattccttagccaatttgaagtctctgcggcggctgcatctc
cacagcaatcttctggtgacagtccctgcctcgcttgccagcctgcccaacttgtctaga
cttgatctgcagaacaattgcctccgtgctgtcccccctgagatccagacctcaccattc
gtgcacctccgaggcaatcccttaggagaaactgagccatccccacaggctgatgaatcc
agtgccggagagctacgaagacttttccttccatcaggagaggacagctttactgtcacc
tctgaaggctgcaaagtggtcctggcctgtggcattcgtttctactttccaccgggggct
gcctctgaccctctacagatctacttccgaaccctggcaccagaccctcaatgcgtaaag
ctgagacaccatgatgtcctgctaagtagagtcctggagctgcagcctcatggggtcaaa
ttccagcagaaggtgcagatctggatgccatatgcctcccctcaaacccttcaccagcgt
gaggtggtagttcggacattcagtgggcagaactggagtgatctgagcacaagagtgaag
cagaagagaaaatcaaagaagcacatggctcactgtagcgtccttcacttctcttggttc
ctcgttgtgtctcgacttgtgcaaaatgaatgcaaagtgccaacagaggggacattgctc
ttttccagtgtggatccaaacatcaaagtgacctttccccctggagtcactgaagagact
cgcaatgtcaagctgcaggtgctgccaatctctgcagaagagatagaggaaatcacagcc
gatgcaggatgcagagccagtcccttgctctgcctctcccaggactccctggtggatttt
ctcaggccagtgagaattcagctgcccctcccacctggggtcacagggctaaatttggat
cagtcaagactgcatcttctccatggcgacctggagggcaaaacctgggatgacattacc
agtcaggtggtgctggaattcacccatatttatgcagtgtttgaagtcactcacttctca
tggtactggctgtggtacaccaccaagacctacgttggaggcattgccaagaaagtctat
gaacggctgcgtatgtaccaggtgaacttcattgctctgcagaggaagagggaccccgag
caagtcctactacagtgtgtccccaagcacaaggttgatccagtgctgaagaagcttcag
gatcgctatcaaggacctgagccatccgacatggtggagatgtttgaaggagagcaattt
tttgcagcttttgagcgaggcatcagcattgatatggatcgccctgattgtgtggatgga
cgtctctcatttattttttactcccacttgaagaacatgaaggaaatctatgtgacctcc
cctgtagacaggaaaggccaagctgtcaaaggccaggtctctttctaccgagcggcagta
cctgacagcatccctgaagatgccagcaggaggaggaaaggaccagactccctctggctc
gctaccttgcccatcaaactacctcgattgaaaccccgctggggtgagaaccgaggtccc
ccaaatggcttctccttccctcccttgaacctgggcaatgctgagactggctacctgaca
cagacaaacctgctgagcattgccaggcgtgtaggagctgactggcagaccatcggcctg
aaccttggcttgacataccagcagattgagcgcataggatacaataacagagaggacctt
gataagcagatcctggacatgcttttctcatgggctcagcaaaactcagaggatcctgac
tgtgtgagcaagttgattacagccatgaaagagagtggccgccaggacatcgctgatgag
gttgaaaccatcattgagctgggacagcagaaatacagggagtccatccgccgtgtgggc
ttggagcaggagagcagcactgaggactctgcaacagccatgatgtag

DBGET integrated database retrieval system