KEGG   Columba livia (rock pigeon): 102093092
Entry
102093092         CDS       T02912                                 

Gene name
SESN1
Definition
(RefSeq) sestrin-1 isoform X3
  KO
K10141  sestrin 1/3
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102093092 (SESN1)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 102093092
NCBI-ProteinID: XP_005509536
LinkDB
Position
Unknown
AA seq 481 aa
MLSKRCPFPDVREKSEAILSGVQELGIRIPRPLGHGPSRFIPEKETIQVGKEDAMMHTLF
ADSFATLGRLDNVTLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCS
YLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKMLAHRPWLITKEHIEQLLKTEE
NSWSLAELIHAVVLLTHYHSLASFTFGCGISPEIDCEGGHTFRPPSVSNYCICDITNGYH
GVDDVHASPTGSIPSTESVCEVEALMEKMKQLQECRDEEEASQEEMATRFEREKRESMFV
CSSEDEESAPARDVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYSWEDHGYSLVNRLYPDV
GQLLDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEINQLLDR
SFKVYIKTVVCTPEKTTKRMYDSFWRQFEHSEKVHVNLLLVEARMQAELLYALRAITRYM
T
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgctctccaagcgctgtccgttccccgacgtgagggagaagagcgaggcgatcctcagc
ggggtgcaggaacttgggataagaattcctagaccactgggacacggaccaagcagattc
atccccgagaaggagacgattcaagtgggaaaggaagacgccatgatgcacacgctgttt
gcagattcttttgccacgctgggccgattggacaatgttaccttggtgatggttttccac
ccacagtatcttgaaagctttctgaaaactcagcactatctactgcaaatggatggtcca
ctcccgcttcattaccgacactacatcgggataatggctgcagcacgacaccagtgctct
tacctggttaacctccatgtgaatgacttccttcatgttggtggagaccctaaatggttg
aatggcctggaaaatgcacctcaaaagctgcagaatttaggagaactgaacaaaatgttg
gctcatagaccctggcttatcaccaaggaacacatcgagcaacttttgaagactgaagag
aacagctggtccctggcagagctgatccacgcggttgttctcctcacacactaccattcc
cttgcttccttcacctttggttgtgggatcagtccagagatcgactgcgaagggggtcac
accttcaggcccccttccgtcagtaactattgcatctgcgatatcacaaatggttaccac
ggggtggatgatgttcatgctagcccaactggaagtatcccatctacagagtctgtctgt
gaagttgaagctcttatggagaaaatgaagcagctacaggagtgtcgagatgaagaggaa
gccagccaagaagagatggctacacgttttgaaagagagaagagagaaagcatgttcgtg
tgttcctcagaagatgaagaatcggcaccagcaagagatgtgtctcgtcactttgaggac
accagctatggttacaaagacttctccagacatggaatgcacgtgcctacctttcgtgtt
caggattattcttgggaagaccacggctattccttggttaatcgtctttacccagacgtg
ggacaactacttgatgagaagtttcatattgcttataatctgacttacaacacgatggcc
atgcacaaagatgtggatacctcaatgctgagacgagcaatttggaactatattcattgt
atgtttggaataagatacgatgattatgactatggtgaaattaatcagttgttggaccgc
agctttaaagtctatatcaagactgtggtttgcactcctgaaaagaccacaaaacgaatg
tatgatagcttctggaggcagtttgaacactctgagaaggtccatgtaaatttgcttctg
gtagaagctcggatgcaagccgaactactttatgctctgagagctattactcgctatatg
acctga

KEGG   Columba livia (rock pigeon): 102095012
Entry
102095012         CDS       T02912                                 

Definition
(RefSeq) sestrin-3-like
  KO
K10141  sestrin 1/3
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102095012
SSDB
Motif
Pfam: PA26 CMD Leptin
Other DBs
NCBI-GeneID: 102095012
NCBI-ProteinID: XP_021140650
LinkDB
Position
Unknown
AA seq 452 aa
MQTAARRLAGWAALGHRSPGSACPGREGVVKMSGSDPERPQFLFVKVLASRGRLEAVTQQ
MGYHPQYLDSFLKMQHYLLHMDGPLPFDCRHYIAIMAAARHQCRYLVNLHVLQFLRAGGD
PQWLRGLDFIPPKLRNLNEINKILAHRPWLITKKHIEKLLKISEWSWSLAELVHAVVLLA
HCHALASFVFGCGCEQDEGPGGRGSLKPLSPGNQCFCEATDGCSQELLRINRKRSLDSCM
ELDSLRERMQRIHVETEGREETRLLQQDREEDTDGEVTNATNLSCYMQDPDFGYQDFARR
DEDQTQVFRVQDYSWEDHGFSLVNRLYSDIGHLLDEKFRMVDGLQSSAMAKRQGCEPSVF
KRGIWNYIHCMFGIRYDDYDYAEVNQLLERMLKVYIKTVTCYPEKTNPEMFDRFWKQFKH
SEKVHVNLLILEARMQAELLYALQAITQYMIS
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcaaactgctgctcggcgattggctggctgggcagcgctggggcatcgttcccccggc
agtgcctgcccgggcagggagggggtagtgaagatgtccggcagtgaccccgagcgtcct
cagttcctattcgtgaaggtgctggcgagccgggggcggctggaggcggtgacccagcag
atgggctaccacccacagtacctcgacagcttcctcaagatgcagcactacctgctgcac
atggacggcccgctgccctttgactgccggcactacattgccatcatggcagctgcccgg
caccagtgccggtacctggtgaacctgcatgtgctgcagttcctgcgggcagggggtgat
ccccagtggctgcgcggcctcgacttcatccccccaaaactccgcaacctcaacgagatc
aacaagatcctggcgcaccggccatggctcatcaccaagaagcacattgagaagctgctg
aaaatcagtgagtggagctggtcactggcagagctggtacatgccgttgtcctcctggca
cactgccacgcactcgccagctttgtcttcggctgtggctgcgagcaggacgaggggcca
ggaggccgaggctccctgaagcccttgtcacccgggaaccagtgcttctgcgaagccacc
gacggctgcagccaggagctgctgcgcatcaaccgcaagcggtccctggactcctgcatg
gagctggattccctccgggaacgcatgcagcggatccacgtggagactgagggcagggag
gaaacaaggctgctgcagcaggaccgagaggaagataccgacggggaagtcaccaatgcc
accaatctttcatgctacatgcaggaccccgactttggataccaggactttgcccggcgc
gatgaggatcagacgcaggtattcagagtccaggattactcctgggaagaccatggcttc
tcgctggtcaaccggctctactctgacatcggtcatctcctggatgagaagtttcggatg
gtggatggtctgcaaagcagtgccatggccaagcgccagggctgtgaaccctctgtcttc
aagcggggcatctggaactacatccactgcatgtttggcattaggtacgatgactacgac
tacgcagaggtgaatcagctcctggagcgaatgctcaaggtttacattaaaaccgtaacc
tgctacccagagaagacaaacccagaaatgtttgacaggttctggaagcagttcaagcac
agtgaaaaggtccatgtgaacttgctgatcctggaagcccgaatgcaggcagagctgctg
tacgcgttgcaggccatcacccagtacatgatctcctag

KEGG   Columba livia (rock pigeon): 102095747
Entry
102095747         CDS       T02912                                 

Gene name
SESN2
Definition
(RefSeq) LOW QUALITY PROTEIN: sestrin-2
  KO
K20394  sestrin 2
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    102095747 (SESN2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102095747 (SESN2)
SSDB
Motif
Pfam: PA26
Other DBs
NCBI-GeneID: 102095747
NCBI-ProteinID: XP_021140824
LinkDB
Position
Unknown
AA seq 524 aa
MWQLGTGGFAGVAAAQRWRERCDPLPDTWGACGHRDSCCLVTSCHTTPQCPQAVPTAVTV
AWRQRQEKHLLSPGLCPALALGYLLDQGVKVPWQLGRGPSAFIPLEEILQEGAQSSRHQL
LVEAFVSAGRVDNITMVMGLHPQYLNSFWKTQYLLLRPPGSPAGSARHQCSYLVGLHMGE
FLQVGGNPAWLQGLHCAPQKLRNLNEINKLLAHRPWLITKEHIEALLKTGEHSWSLAELV
QALVLLTHYHSLASFVFGCGINPEEEQAGGHGWRAPPAPQRQASPSSQFPRXGRGGKDGL
REVEVLMERMKLLQESQLEEEGVTQEEMATRFELEKTESLLVAPSDLSEHSLQSNVLCFV
EDPEFGYKDFTRRGEQAPPTFRAQDYTWEDHGYSLINRLYPDVGQLLDEKFQVVYNLTYN
TIAMHCGVDTSMLRRAIWNYVHCVFGIRYDDYDYGEVNQLLERSLKIYIKTVACYPEKTT
KRMYTQFWRHFKHSEKVHINLLLLEARMQAALLYALRAVTRYMT
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtggcagttgggcaccggtggctttgctggggtggcagcagcccagcgctggcgggag
cgctgtgacccactgcccgacacgtggggagcatgtggccaccgcgacagctgctgcctt
gtcacctcgtgccacactacaccccagtgcccccaggctgtgcccaccgctgtgacagtg
gcttggaggcagcggcaggagaagcacctgctgtcacctgggctgtgcccggcgctggct
cttgggtatctcctggatcaaggggtgaaggtcccctggcagctggggagggggcccagc
gccttcatccccctggaagagatcctgcaggaaggtgcgcagagcagccggcaccagctc
ctggtcgaagccttcgtgtcggcggggagggtggacaacatcaccatggtcatggggctg
cacccccagtacctgaacagcttctggaagacccagtacctgctgctgcgaccgcctggc
tctcccgcaggcagcgcccggcaccagtgctcctacctggtgggtttgcacatgggggag
ttcctgcaggtggggggcaacccggcctggctgcaggggctgcactgtgccccccaaaaa
ctcaggaacctcaacgagatcaacaagctgctggcgcaccggccctggctcatcaccaag
gagcacatcgaggcgctgctgaagacgggggagcacagctggtcgctggcggagctggtg
caggcgctggtgctgctcacccactaccactcgctcgcctccttcgtcttcggctgcggc
atcaaccccgaggaggagcaggctggggggcacggctggcgggccccccccgccccccag
cgacaggcttccccctcctcacagttcccgcgatgaggcaggggaggcaaggacgggctg
cgggaggtggaggtgctgatggagaggatgaagctgctgcaggagagccagctggaggag
gagggcgtcacgcaggaggagatggcgacgcgcttcgaactggagaagacggagagtttg
ctggttgctccctcggacctgtcggaacactccctgcagtccaacgtcctctgcttcgtg
gaggaccccgagtttggctacaaggacttcacgcggaggggcgagcaggcgccccccact
ttccgggcacaggattacacatgggaggaccacggctactcactgatcaaccgcctgtac
cccgacgtggggcagctcctggatgagaagttccaggttgtttacaacctgacgtacaac
accatcgccatgcactgcggtgtggacacgtccatgctgcgcagggccatctggaactac
gtccactgtgtctttggcattcgctatgatgactatgactacggggaggtgaaccagctc
ctggagcgcagcttgaagatctacatcaagacggtggcctgctacccggagaagacaacc
aagcggatgtacacgcagttctggagacacttcaagcactcggaaaaggtgcacatcaac
ctgctcctgctggaggctcggatgcaggcggctctgctctacgccctgagagccgtcacc
cgctacatgacctga

KEGG   Columba livia (rock pigeon): 102096978
Entry
102096978         CDS       T02912                                 

Gene name
SESN3
Definition
(RefSeq) sestrin-3 isoform X1
  KO
K10141  sestrin 1/3
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102096978 (SESN3)
SSDB
Motif
Pfam: PA26 CMD PEX11 KIP1
Other DBs
NCBI-GeneID: 102096978
NCBI-ProteinID: XP_005505435
UniProt: A0A2I0LVS1
LinkDB
Position
Unknown
AA seq 468 aa
MAVLQEKRVQVSPPLTRGPSAFIPENEVMQANGLDERTNLLVEEYSTSGRLDNITQVMSI
HTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMAAARHQCSYLINMHVDEFLKTGGIAEW
LNGLEYIPQRLKNLNEINKLLAHRPWLITKEHIQKLVKTGENNWSLPELVHAVVLLAHYH
ALASFVFGSGINPERDPDASNGVRLIAVNNFCVCDLANDNNIENASLTSSNFGNVMVFLQ
IAESLSELEALMERMKRLQEDKEDEEASQEEMATRFEKEKKESLLVINGAFDDEIVSTDV
SRYIEDPGFGYKDFARRGEDHLPTFRAQDYTWENHGFSLVNRLYSDIGHLLDEKFRMVYN
LTYNTMATHEDVDTTTLRRALFNYVHCMYGIRYDDYDYGEVNQLLERSLKVYIKTVTCYP
ERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAELLYALRAITRHLT
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggctgttttgcaggaaaaaagagtacaagtctccccgccgctgacaagaggaccaagt
gcctttataccagagaacgaagttatgcaagcaaatggtttggatgaacgtaccaatctt
cttgtggaagaatactccacgtctggtcgcctggacaacatcacgcaggtcatgagtatc
catacgcagtacctggagtctttcctccgcagccagttctatatgttgcgcatggacggg
ccccttcctttgccctataggcactacattgctataatggctgcggccagacatcagtgt
tcctacctaataaacatgcacgttgatgagtttttgaagaccggcgggattgcagagtgg
ctgaacggtttagaatacattccccaaagactgaaaaatctgaacgaaataaacaaactc
cttgcacaccggccctggctgatcacaaaagagcacattcagaaacttgtcaagactggg
gaaaataattggtctcttcctgagctggtgcatgctgttgtcctgttggcacattatcac
gccttggcgagttttgtatttggtagcggcattaatcccgagagagatccggacgcgtct
aacggagtcagactcatcgcggtcaacaacttctgcgtctgcgatcttgccaacgacaac
aacatagaaaacgcgtccctgacaagtagcaactttgggaatgtcatggtgtttttgcag
attgcagagtctttaagtgagctggaggccttaatggaaaggatgaagaggctacaagaa
gataaagaggacgaagaagcctctcaggaagaaatggcaactcgctttgaaaaggagaag
aaggagagtctgctagtaattaatggagcatttgatgatgaaatagtttctacagatgtc
tcccgctatattgaagatcctgggtttgggtacaaagactttgcaaggcgaggagaagac
catctgccaacattcagagctcaggactatacttgggaaaatcatggcttttcccttgta
aacaggctttattctgatattgggcatctccttgatgagaagtttcggatggtatataac
ctcacatataacactatggcaacccatgaagatgttgatacaactactctaagaagagct
ttatttaactatgtccactgtatgtatggaatcaggtatgatgactatgattatggagaa
gttaatcagttacttgaacgcagcctgaaggtttacataaagacagtgacctgctaccca
gagagaactaccaagcgcatgtacgatagttactggcgtcagttcaagcactcggagaag
gttcacgtcaatctacttctaatggaagctcgtatgcaagccgaacttctgtacgccctt
cgtgccataactcgtcacttaacctga

DBGET integrated database retrieval system