KEGG   Columba livia (rock pigeon): 102093174Help
Entry
102093174         CDS       T02912                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00512  Mucin type O-glycan biosynthesis
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102093174 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:clv01003]
    102093174 (GALNT9)
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102093174 (GALNT9)
Glycosyltransferases [BR:clv01003]
 O-Glycan biosynthesis
  Mucin-type
   102093174 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 102093174
NCBI-ProteinID: XP_005498343
UniProt: A0A2I0M8G0
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MLMRTEHPGFLRVADDRAALWPALPGHRAVGPRDLGAATRIRHQRQRPLQPPLRIQDRSQ
ELVQIVRSADRRARSRGAKVGSLADRESILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGL
GQGGMAATLRDDSHESETKYEEYGYNAQLSDRISLDRSIPDYRPKKCKQMSYPDDLPQIS
VVFIFVNEALSVILRSVHSVVNHTPSHLLKEIILVDDNSDNVELKFNLDQYVNKRYPGLV
KIVRNTKREGLIRARIQGWKAATSPVVGFFDAHVEFNIGWVEPALTRIKDDRKRIILPAI
DNIKYNTFEVQQYANAAHGYNWGLWCMYIIPPQDWLDKGDESAPIRTPAMIGCSFVVDRE
YFGEIGLLDPGMEVYGGENIELGMRVWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAK
RNALRAAEVWMDDFKSHVYMAWNIPMANPGVDFGDVSERIALRQRLQCRSFKWYLENVYP
EMRVYNNTVTYGEVRNSKASGYCLDQGAEEDDKAILYPCHGMSSQLVRYSSEGVLQLGPL
GSTAFLPDSKCLVDDGKGRTPTLKKCEDVLRPAQRFWDFTQNGPIISRDTGRCLEVEMSK
DANFGLRLVVQRCSGQKWMIRNWIKHGRH
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgaggaccgagcacccaggttttctcagagttgctgatgacagagcagcgctc
tggccagctctgcccggccaccgcgcggtgggaccgcgggatctgggagccgcaacgcgg
atcaggcaccaaaggcagcgaccgcttcagccacctttgcggatccaggaccgctcccag
gagctggtgcagatcgtccggagcgcagaccgccgggccaggagccgcggcgccaaggtg
ggcagcctggccgacagggagtccatcctgcagcgcctggaccacctggaggaagtggtc
tacaaccagctcaatggtctggcaaagcccatgggattagttgaaggtccagggggcttg
ggccaggggggaatggccgctaccctgagggacgacagccacgagtcggagaccaagtac
gaagaatacggttacaatgcccagctcagtgaccggatatcactggacaggtccatccct
gactacagaccgaaaaagtgcaaacagatgagctaccccgacgacctgccccagatctct
gtggtctttatatttgtgaacgaggcactgtcggtgatcctgcgctccgtgcacagcgtg
gtcaatcacaccccctcgcacctgctcaaggagatcattctggtggatgacaacagtgac
aacgttgagctgaaatttaacctggaccagtacgtgaataaaagataccccggcctggtg
aaaatagtgcgcaataccaaacgagaagggctgattcgagccaggatccaaggctggaaa
gcagcgacctctcctgtcgtggggttctttgacgctcacgttgagttcaacattggctgg
gtggaacctgcgcttacccgcatcaaagacgaccgaaagcggatcatcttaccagccatt
gacaatatcaagtacaacacttttgaagtgcagcaatacgccaacgcagcccacggctac
aactggggcctctggtgcatgtacataatcccaccgcaggactggctcgataaaggggat
gagtcggctcccatcaggacaccagccatgattggatgctcgtttgtagtagaccgagag
tattttggggagatcggcttgctcgaccctggcatggaggtctacggaggagaaaacatt
gaactgggcatgagggtgtggcagtgcggagggagcatggaggtgctgccctgttcccgt
gtggcacatatcgagcgcacaaagaagccctacaacaacgacatcgattactatgcaaag
cgcaacgccctgcgcgccgccgaggtctggatggacgacttcaagtcccacgtgtacatg
gcgtggaacatccccatggcgaaccctggagttgactttggagacgtttctgagagaata
gccctacggcagcggctgcagtgccggagtttcaagtggtacttggagaacgtctatcct
gaaatgagggtgtataataacaccgtcacttacggagaggtgcgtaacagcaaggccagt
ggctactgcctagatcagggagccgaggaggatgacaaggccatcctctacccgtgccat
ggaatgtcctcccagctggtgcgctacagctcggaaggtgtcctgcagctgggcccgctg
ggctccaccgccttcctgcccgactccaaatgcctcgtggacgacggcaagggccggaca
cccactctgaagaagtgtgaagatgtcctgaggccagcacagcgcttctgggacttcaca
cagaatggtccaatcatcagcagagacactggccgctgtctagaagtggaaatgtcaaag
gatgcaaattttgggctcagattggttgtacaaaggtgctcggggcaaaaatggatgatt
agaaactggatcaaacacggtcgacactga

DBGET integrated database retrieval system