KEGG   Columba livia (rock pigeon): 102093181Help
Entry
102093181         CDS       T02912                                 

Gene name
OGDHL
Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial isoform X1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00020  Citrate cycle (TCA cycle)
clv00310  Lysine degradation
clv00380  Tryptophan metabolism
clv01100  Metabolic pathways
clv01200  Carbon metabolism
Module
clv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
clv_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102093181 (OGDHL)
  Amino acid metabolism
   00310 Lysine degradation
    102093181 (OGDHL)
   00380 Tryptophan metabolism
    102093181 (OGDHL)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     102093181 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 102093181
NCBI-ProteinID: XP_005500169
UniProt: A0A2I0MFE3
LinkDB All DBs
Position
Unknown
AA seq 1014 aa AA seqDB search
MSHLKLFAATLKWQGIKLLEKQYIARRVFLHGQRCFSSGTSEPFLSGSNSNYVEEMYYAW
LENPKSVHKSWDLFFQNANASQARDPQLPDQLERKASFLQSHGLAQTPGKTEKLVEDHLA
VQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLGFYGLHESDLDKVFQLP
TTTFIGGNENSLSLREIIKRLENTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMKFTNE
EKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIEYVIMGM
PHRGRLNVLANVIRKELEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRATNKKITLS
LMANPSHLEAVDPVVQGKTKAEQFYRGDTAGKKVMSILLHGDAAFAGQGVVYETFHLSDL
PSYTTNGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCSV
AAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLIADGT
VTLQEFEEEIAKYDRICEEAYTRSKDNKILHIKHWLDSPWPGFFNMDGEPKSMSCPPTGI
SEDLLTHIGNVASSVPVKDFKIHAGLSRILRARLEMTKNRVVDWALAEYMAFGSFLKEGI
HVRLSGQDVERGTFSHRHHVLHDQEVDKRTCVPMNHLWEQQAPYTVCNSSLSEYGVLGFE
LGFAMASPNALVCWEAQFGDFHNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEGMGPE
HSSARPERFLQMSNDDSDAYPEFSEQFEVSQLYECNWIVVNCSTPANYFHVLRRQILLPF
RKPLIILTPKSLLRHPEAKSSFDEMVSGTTFQRVIPENGLAAHAPHEVKRVIFCTGKVYY
DLVKERKNQDLEKQVAITRLEQISPFPFDLLKEELEKYPAADLVWCQEEHKNSGYYDYVK
PRFRTIVNHTRPIWYVGREPAAAAATGNKNMHLVSLRRFLDTAFNLEAFEGKTF
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatctgaagttgtttgcggccacattgaagtggcaaggcattaaacttctggaa
aagcaatatatagccagaagggtatttttacatggccaacggtgtttttcatcaggaacc
tcagaaccattcctgagtgggagtaattcaaattatgtggaggaaatgtattatgcgtgg
cttgaaaaccctaaaagcgtacataagtcctgggatttgtttttccaaaatgctaatgcc
agccaagcacgtgatccccaactaccagatcagttggaaagaaaggcatcgtttcttcag
agccatggcctggcccagacaccgggtaaaactgagaagcttgttgaagatcaccttgct
gtgcagtctttgataagagcataccaaatccgtggccatcatgtggctcagctggatccc
cttggaattctggatgcagacttggattcgtttgttccatctgacttaatcactacgatc
gataaacttgggttttatggtttgcatgaatcagatttggacaaagtctttcagctgcct
acaaccaccttcataggaggaaatgagaacagcctgtctttacgagagatcatcaaacgg
ctggagaatacgtactgccaacacatcggcttggagttcatgttcatcaatgatgtggag
cagtgccagtggatccggcagaagtttgagacaccgggagttatgaagtttactaatgag
gagaaaaggactttgttggcaaggctggtgcgctccatgagatttgaagacttccttgct
cgcaagtggtcttccgaaaagagatttggtttggaaggatgtgaagtaatgattcctgca
cttaagaccatcattgataaatccagtgaaatgggaattgaatatgttataatggggatg
cctcataggggtaggctcaatgtattggctaacgtgatccgaaaagagctggagcagatc
ttctgtcaatttgatcccaaacttgaagcagctgatgagggatctggggatgtaaaatat
catctgggaatgtaccatgagaggatcaaccgagcaacaaacaagaaaatcactctgtcc
ctgatggctaacccttctcacttggaagcagttgatcctgttgtgcaggggaagacaaaa
gccgaacagttttatcgaggggatacggcagggaaaaaggttatgtccatattgttacat
ggggatgctgcctttgcaggacaaggagtggtttatgaaacatttcaccttagtgacctc
ccatcctacaccacaaatggcactattcatgttgtggtcaacaaccagattggcttcacc
acagacccccgtatggcccgttcatctccatatcctactgatgttgctcgtgtagtcaat
gctcccatttttcatgtgaatgctgatgaccctgaagcagtgatgtatgtgtgcagtgta
gctgcagaatggcgaaacaccttcaataaagatgtggtggttgacttggtttgttaccgt
aggagggggcacaatgaaatggatgaaccgatgttcacgcagcctctaatgtacaagcag
atccataagcaggtgccagtgctgaagaaatatgctgacaaactgattgcagatgggact
gtgacactgcaggagtttgaggaagaaattgcaaagtatgatagaatatgtgaagaagca
tatactagatctaaggataataaaatcctacatatcaagcactggcttgattcaccttgg
cctggattctttaacatggacggagaacccaagagcatgtcttgtcctccaactggcatt
tcggaagacctgctgactcacattggcaatgtagctagttcagtgccagtcaaagacttc
aaaatacatgcaggactctctcggattttaagagcccgcttggaaatgaccaagaacagg
gttgttgactgggccttagcagaatacatggcttttggctcttttctgaaagaagggatc
catgtccggctgagtggacaggatgtggagaggggcacttttagccatcgtcatcatgtg
cttcatgatcaagaagttgacaagagaacgtgtgtccccatgaatcacctctgggagcag
caggccccctacaccgtgtgcaacagctccctctctgaatacggcgtcttaggttttgaa
cttggctttgctatggcgagtcccaatgccctggtgtgctgggaggcccagtttggcgac
ttccacaacacagcgcagtgtataatagaccagttcatcagctccggccaggccaagtgg
gttcgtcacaacgggatcgtcctgctcttgccacacggaatggaaggaatgggtccagag
cattcatcagccaggcctgagaggtttctgcagatgagcaatgatgattctgatgcttat
ccagagttcagtgagcagtttgaagtttcccagctgtatgagtgcaactggattgtggtg
aattgttcaactccagccaattactttcacgtcctcagaagacagatcttgctgccgttc
agaaaaccgctgattattttgacacccaagtcactgctgaggcatccggaagctaaatcc
agttttgatgaaatggtgtctggtaccaccttccagcgtgtgattcctgagaatggcctg
gcagctcatgcaccacatgaggtcaagcgagtgattttctgcacgggaaaagtctactat
gatcttgtgaaagagagaaagaatcaagacctggagaaacaagttgctataaccagactt
gagcagatctcaccattcccttttgacctgctgaaagaagaacttgagaagtatccagct
gctgatctagtttggtgtcaggaggaacacaaaaacagtggatattatgattatgtaaaa
cctcgtttccgtactattgtgaaccacactcgacctatatggtatgttggccgagagcct
gctgctgcagctgccacgggcaacaagaacatgcatctggtgtcactcaggaggttcttg
gatacagctttcaacctggaggcctttgagggaaagaccttctaa

DBGET integrated database retrieval system