KEGG   Columba livia (rock pigeon): 102093220
Entry
102093220         CDS       T02912                                 

Gene name
SERPINB5
Definition
(RefSeq) serpin B5
  KO
K10139  serpin B5
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102093220 (SERPINB5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:clv01002]
    102093220 (SERPINB5)
Peptidases and inhibitors [BR:clv01002]
 Peptidase inhibitors
  Family I4: serpin family
   102093220 (SERPINB5)
SSDB
Motif
Pfam: Serpin Toprim_Crpt
Other DBs
NCBI-GeneID: 102093220
NCBI-ProteinID: XP_005509792
UniProt: A0A2I0MW19
LinkDB
Position
Unknown
AA seq 377 aa
MTMDALQLANTAFAVDMFKKLCENDKTANIIFAPLCTSTSLALAYKATKGDTADQMKQVL
HLQDVKDVSFGFQTVTSDVSKLSSFFALKMVKRLFVDKSLNPTTDFVNSTKRPFPSELEL
VDFKEKTEETRQKINKSLSELTDGKMENIVNEDSVSDQTQILLVNAAYFVTNWMKKFPEA
EIKECPFKVNKTETKPVQMMNLEATFCLGYVKELNVAILELPCLNKHISMLILLPKEIED
ETTGLEKLEKALTPETLLQWTNPSMMANTKVNVSLPKFSVEGDYDLKPLLESLGMTNVFN
ESASDFSEMCETKGVVLSKIIHKVSLEVNEQGGESREVPGYRILQHKDEFKADHPFIFLF
RHNKTRNVILSGRFCSP
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgacaatggatgctctgcaactagcaaacactgcctttgcagttgatatgttcaaaaaa
ctgtgtgagaatgacaaaacagccaatattatttttgcgccgctgtgtacctcaacgtct
ctggctctggcatataaagctacgaaaggtgacactgcagaccagatgaaacaggtactc
catttacaagatgtcaaagacgtttctttcggatttcaaacagtaacttcagatgtttcc
aaactcagctctttctttgcactgaaaatggtcaaacggctcttcgtagacaagtctctt
aatcctaccacagactttgtcaactccacaaagaggccttttccatctgaactggaatta
gtggacttcaaagaaaaaactgaggaaacccgacagaagatcaacaaatctctttcagag
ctaactgatggcaaaatggagaatattgtgaacgaggatagtgtaagtgaccagactcag
atcctcctagttaatgcagcttattttgtcacaaactggatgaagaagttcccagaggca
gagatcaaagaatgtccttttaaagtcaacaagactgaaactaaaccagtgcaaatgatg
aatctggaagctactttttgcctgggctatgtgaaagaattaaatgttgccatccttgag
cttccatgccttaacaaacatataagcatgctcattctgctgcccaaagagattgaagat
gagaccaccggcttggagaagctggaaaaggcacttacccctgagacattattacagtgg
accaatcccagcatgatggccaacacaaaagtgaatgtatctcttccaaagtttagcgtg
gaaggtgattatgacctgaagccacttctggaaagcctgggaatgacaaatgtcttcaat
gagagtgcgtcagatttctctgagatgtgtgagacaaaaggtgtggttttgtcaaagatc
atccataaagtctctttggaagtaaatgagcaaggtggcgagtcccgagaagtaccagga
tataggattctgcaacataaagatgaatttaaagctgaccatccatttatctttttattt
agacacaacaaaactcgcaatgtgattctttcaggccgattctgttccccttaa

DBGET integrated database retrieval system