KEGG   Columba livia (rock pigeon): 102093506
Entry
102093506         CDS       T02912                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv04370  VEGF signaling pathway
clv05164  Influenza A
clv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102093506 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102093506 (CASP9)
   04115 p53 signaling pathway
    102093506 (CASP9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102093506 (CASP9)
   05168 Herpes simplex virus 1 infection
    102093506 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:clv01009]
    102093506 (CASP9)
   01002 Peptidases and inhibitors [BR:clv01002]
    102093506 (CASP9)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     102093506 (CASP9)
Protein phosphatases and associated proteins [BR:clv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102093506 (CASP9)
Peptidases and inhibitors [BR:clv01002]
 Cysteine peptidases
  Family C14: caspase family
   102093506 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 EPO_TPO
Other DBs
NCBI-GeneID: 102093506
NCBI-ProteinID: XP_021150888
LinkDB
Position
Unknown
AA seq 335 aa
MLMQECGHLPAPPQLGDLRPVELDLRGEKHSKNVSFPGRLSVPIQAESERPQMPPMPAQG
SAVDKRNRDLVYELKSDPCGRCLILNNVNFSRDSDLSTRDGSDVDCEKLEKRFKALSFDV
LTRRDLPAQKMVSELQELARQDHSALDCCVVVILSHGCQTSHIQFPGGVYGTDGKAIPVE
KIVNYFNGSHCPSLRGKPKLFFIQACGGEQRDRGFVVDGDSPGDEAPGGSLESDTTPFQT
PAGNVDQPDAVASLPTPSDILVSYSTFPGFVSWRDASSGSWYVETLDSVLEQYARSEDLL
NMLLRVANAVSAKGRYKQIPGCFNFLRKKFFFRCK
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgctgatgcaggagtgtgggcaccttccagcaccgccacagctgggggacctgaggcca
gtcgagctggacctgcgtggagaaaaacatagtaaaaatgtgagcttccctggacgtctg
tctgtcccaatccaagctgaaagtgaaagacctcaaatgcctcccatgccagcccagggt
tcagctgttgacaagaggaaccgtgacctggtttatgagctgaaatcggacccgtgtggc
cgctgcctgatcctcaacaacgtcaacttcagtagagactcggatctgtcgacccgagat
ggctctgacgtggactgcgagaagctggagaagcgtttcaaggctttgagctttgacgtc
ctgactcggcgggatctcccagctcagaaaatggtttcggagctgcaggagctggcgcgg
caggaccacagtgccctggactgctgcgtggtggtgatcctttcccacgggtgtcagacg
agccatattcagtttcctggaggcgtttacggaacagatggaaaagccattcccgtagaa
aagattgtgaactatttcaatgggtcccattgcccgagtttgagaggaaaacccaaactc
ttcttcatccaggcctgtggtggagaacaaagagatcgaggctttgtcgtggatggtgat
tcacccggtgacgaagctcctggaggttctttagagtcagacacgactccttttcagact
ccagcaggtaatgtggaccagccggatgctgtcgccagtttgcccacgcccagcgacatc
ttggtctcctactcaactttcccaggttttgtctcctggagggacgcatcgagtggctca
tggtacgtggagacgctggacagcgtgctggagcaatatgcccgttccgaagatctgctg
aacatgttactacgggtggcaaacgctgtctctgccaaggggaggtacaagcagatccca
ggatgtttcaacttcctccgtaaaaagttcttcttcaggtgcaaatga

DBGET integrated database retrieval system