KEGG   Columba livia (rock pigeon): 102093622
Entry
102093622         CDS       T02912                                 

Gene name
AIFM2
Definition
(RefSeq) apoptosis-inducing factor 2
  KO
K22745  apoptosis-inducing factor 2
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102093622 (AIFM2)
SSDB
Motif
Pfam: Pyr_redox_2 K_oxygenase Pyr_redox Pyr_redox_3 NAD_binding_9 DAO GIDA HI0933_like DUF4147 Lycopene_cycl Trp_halogenase
Other DBs
NCBI-GeneID: 102093622
NCBI-ProteinID: XP_021148587
LinkDB
Position
Unknown
AA seq 371 aa
MLRLPVEPHRAPSGVKGTGGLATRRRCWGCCLCCGPCCRLPALHTGFARKTFISYSVTFG
DSFRQGEVVGIDPARQRVLLSDGEELHYSHLILATGSDGPFPGKFNQVIDMESAIQTYED
MVKEIEKSERILVVGGGAAGVEMAAEIKTEYPAKEVTLIHSKVVLADVELLHSVRQEAKE
ILLRKGVRLLLGERVSDVESLTPNRFQKDTVVRTEKGTEVVVDMVVLCTGIKINSSAYAA
AFGDRLASNSALKVNKHLQLEGYENIYAIGDCADLKEPKMAYHAGLHANVAVTNIINSLT
HKPLKTYKPGKVICFPVGTAVKCAHIGTCAGQVTVGQVNGYYVGRLLVTIAKSRDLFVSK
SWKTMGQTMPS
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgctccggctccctgtggaaccgcaccgagcccccagtggggtgaagggcacggggggt
ctggccaccaggagaaggtgctggggctgctgcctctgttgtggcccctgctgcaggctc
cctgcgctgcacacagggtttgccaggaagactttcatctcctactccgtcacctttggg
gacagcttccgacaaggcgaggttgttggcatagaccctgcgaggcaacgagtcttgctc
agcgatggcgaggagcttcactactcccatctcattcttgcgacaggcagtgatgggcca
ttccctgggaagttcaaccaagtcattgacatggaaagcgccatccagacctatgaagac
atggttaaggagattgagaaatctgagcgcatcctggtggtgggaggtggtgctgctgga
gtggagatggctgcagagatcaaaactgagtacccagccaaagaggtcaccctcattcac
tcgaaggtcgtgctagctgatgtggagctgctacatagcgtccgtcaggaggccaaagag
attctccttaggaaaggagtgcgcctcctgttaggtgaaagggtcagcgatgtggaaagc
ctcacgccaaaccggttccagaaggacacggtagtaaggacagaaaagggcaccgaggtg
gttgttgacatggtggtcctgtgcactgggataaagattaattcttcagcatatgctgct
gcattcggggacagactggcgagtaacagcgcgttgaaggttaacaagcacctccagctg
gaaggctatgagaacatctacgccattggggactgcgcagatctgaaagaaccgaagatg
gcctatcacgctgggctccacgccaacgtcgccgtgacgaatatcatcaacagcctgaca
cataagcctcttaaaacctacaaaccaggtaaggtaatctgctttcctgtaggaacagct
gttaaatgtgcacacatcggaacgtgcgcaggacaggtcactgttggccaggtgaacggt
tactatgtggggcgtctcttggtgaccattgctaagagcagggacctgtttgtctccaag
agctggaagacaatgggacagacgatgccttcttag

DBGET integrated database retrieval system