KEGG   Columba livia (rock pigeon): 102093655
Entry
102093655         CDS       T02912                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv04217  Necroptosis
clv05164  Influenza A
clv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102093655 (BID)
   04217 Necroptosis
    102093655 (BID)
   04115 p53 signaling pathway
    102093655 (BID)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102093655 (BID)
   05168 Herpes simplex virus 1 infection
    102093655 (BID)
SSDB
Motif
Pfam: BID Bcl-2
Other DBs
NCBI-GeneID: 102093655
NCBI-ProteinID: XP_021140379
LinkDB
Position
Unknown
AA seq 267 aa
MCRFSVLFSSFCTFHGAQSQAQEKGSPRPVSEPCQLPKKRTVRTTFSSASTPFRAEGREF
WCEAEGDKSCCVSESIMEQVNGSVQMESVLLYSFLEVSPDCMFREQLHSLQSQEIVPVLQ
GKYWYDDEMELQTDGNRSGHLLQNGEPVFEPQVDEEVVRLIAVQLAEIGDQFDKEIKTRL
VNDLVQQFLNENLPGEAITRRMSEAVEGLVRAMPPDMEQEKATLVLAMVLTKKIVNTVPS
LLPRVFRTTVNYINQHLHNYIVRMLRG
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtgccgattcagtgtgcttttctccagtttctgtaccttccacggagctcaaagtcaa
gcccaggagaaagggtcacccagacctgtgtcagagccctgtcagcttccaaagaagagg
acagtgaggactacattctcctcagcaagcacaccctttagggcagagggcagggagttc
tggtgtgaagcagagggagacaagagctgctgtgtctctgaatccatcatggaacaggtc
aatggatctgtccagatggagagtgtgctgctctacagcttcttggaggtgtcccctgac
tgcatgttcagagagcaactgcattccctgcaaagccaggagattgtgcctgtcctgcaa
ggcaagtactggtatgatgatgagatggaacttcagactgatggcaataggagtggccac
ttgctgcagaatggtgagccagtgtttgaacctcaggtagatgaagaagttgtccggctc
attgctgttcagctcgctgagattggagaccagtttgataaagaaatcaaaacaagacta
gtaaatgatctagtacagcagtttctgaatgagaatttgcctggagaggcgataacccgg
cgcatgtcagaggcagtggaagggcttgtgcgtgccatgcccccagacatggaacaggag
aaggctactttggtgctagcaatggtcttaactaaaaaaattgtgaatacagtgccttcc
cttctaccgcgtgtcttcaggaccactgtgaactacatcaaccagcatctccacaactac
attgtcagaatgctgcgtgggtga

DBGET integrated database retrieval system