KEGG   Columba livia (rock pigeon): 102093808Help
Entry
102093808         CDS       T02912                                 

Gene name
LIG4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:clv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    102093808 (LIG4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:clv03400]
    102093808 (LIG4)
Enzymes [BR:clv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102093808 (LIG4)
DNA repair and recombination proteins [BR:clv03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     102093808 (LIG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_IV DNA_ligase_A_C BRCT BRCT_2 RNA_ligase mRNA_cap_enzyme Tox-REase-9 DUF2948 SKA1
Motif
Other DBs
NCBI-GeneID: 102093808
NCBI-ProteinID: XP_005507867
UniProt: A0A2I0MSC5
LinkDB All DBs
Position
Unknown
AA seq 912 aa AA seqDB search
MASTPALQPSPKKTVASRVPFADLCSTLERIQKCKSRPDKTKYFKDFLDSWRKFHDALHQ
KEKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDAAKLLNYRTP
AGSRGDAGDFAMIAYFVLKPRSPKQGRLTIEQVNEHLDTIANNNAAKNKGLLKKSLLQLI
TQSTALEQKWLIRMIIKDLKLGISQQTIFSIFHPDALELHNVTTDLEKVCRQLHDPSVSL
SDVSITLFSAFKPMLAAIADVQQIEKQMNNQIFYIETKLDGERMQLHKDGDVYKYFSRNG
FDYTQQFGASPLDGSLTPFIHNVFKSNIQNCILDGEMMAYNPETQTFMQKGNRFDIKRMV
EDSDLQTCFCVFDVLMVNDQKLAHEILTKRYEILSSVFTPLAGRIHVVHKKSARTRKEVI
DALNEAIDNREEGIMVKDPMSTYKPDKRGEGWLKIKPEYVNGLMDELDLLIVGGYWGKGS
RGGMMSHFLCAIAETPPPNEKPTIFHSICRVGSGYTMKELYDLGLKLAKHWKPYHRRDPP
GNILCGTEKPEMYIEPCNSVIVQIKAAEIVNSDMYKTDCTLRFPRIEKIREDKEWYECMT
STMLEDLRSKAEGKLASKHLHIEEYDEPQEKKRKTVSKVRKIIGIAEQFKAPDLSNVSKV
SNMFEDVEFCVMTGMGKYTKSELESRIAECGGSVVQNPGPETYCVIVGAENVRVKNIIAS
NKYDVVRAEWLLQCFQTKMLVPWQPAFMIHMSPDTKEHFAREYDCYGDSYTADTDVAQLK
EVFSRMKDNEVMPSDMIAELEERYSWNSCRLSIFRGNTIYVDCYAVVNEPRTKIQGTTLS
IRALELRFYGAIVVSHLEEGISHVVVGDDRSRVKEMKSLRRTFGIKFKIVSELWVTESVE
EGVLKNENQYLI
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggcttccacacctgcattgcagccttctcctaaaaagacagtggcctctcgtgtgcct
tttgcagatctgtgttctactctggagcgaatacagaagtgtaaatctcgtccagataaa
accaagtacttcaaggatttcctggattcctggagaaagttccatgatgctcttcatcaa
aaagagaaagatgtcacagattctttttatccggcaatgcgacttattcttccacagctg
gaaagagaaaggatggcctatggaattaaagaaacgatgcttgcgaagttgtatattgaa
ctgcttaatttaccaagagatggaaaagatgctgcaaagcttttaaattacaggacacct
gctggctcacgtggagatgctggagattttgcgatgattgcatactttgtgttaaaacct
aggagcccaaaacaaggcagactgacaatagaacaagtcaatgaacacttagatacaata
gctaataacaatgctgctaaaaacaagggtctgttaaagaaaagtcttcttcagttaatt
acccagagcacagcactggaacaaaaatggcttatccggatgattataaaggatctgaag
cttggtattagtcaacaaactatattttcaatttttcatcctgatgctcttgaattacac
aacgtcacaactgatttggaaaaagtttgcaggcaactgcatgatccctctgtctctctt
agtgatgtttctatcacgttattttctgcctttaaaccaatgcttgctgctattgctgat
gtccagcaaattgagaaacaaatgaataaccagatattctacatagaaactaagctggat
ggtgaacgtatgcagctgcacaaagatggagatgtgtataaatatttttcccgaaatggg
tttgactatactcagcagttcggtgcttccccccttgatggttcgttaacaccatttatt
cataatgtatttaagagcaatatacaaaactgcattcttgatggtgaaatgatggcttac
aatcctgagacgcaaacctttatgcaaaaaggaaacagatttgacataaaaagaatggtg
gaggactctgatctgcagacctgcttctgtgtgtttgacgtattgatggttaacgatcag
aagttggctcatgaaatactgaccaaaaggtatgaaatcttaagtagcgtatttactccc
ctagcaggcaggatacatgttgtacacaaaaaaagcgccagaacaagaaaagaagtaatt
gatgctttaaatgaagcaatagataacagagaggaagggattatggtgaaagatcccatg
tctacctacaagcctgacaaacgtggggaaggctggttaaaaatcaagccagaatacgtt
aatgggctgatggatgaactagaccttttaattgtcggtggttactgggggaaaggctct
cgtggtggaatgatgtctcattttctgtgtgctattgcagagacgcctcctccaaatgaa
aaacctaccattttccactctatttgtcgtgttggctctggctatactatgaaggaatta
tacgatctaggtttgaaactggctaaacattggaagccctaccataggagggaccctcct
ggtaatattttatgtggaactgaaaaacctgaaatgtacattgaaccttgcaactctgtc
atagttcagatcaaggcagccgagattgttaacagtgatatgtacaaaactgactgtact
ttgagattcccccgaattgagaagataagagaggacaaagaatggtatgagtgcatgact
tcaaccatgttagaagatctcagaagcaaagcagaagggaagctggcatctaaacacctt
catatagaggagtatgatgagccacaagagaagaaaaggaaaactgtatcaaaggtgagg
aagataattggaatagctgagcagttcaaagctcctgatctttctaatgtaagcaaggtt
tcaaatatgtttgaagatgttgagttttgtgttatgacaggaatgggaaaatacacaaag
tctgaactggaaagcaggatagctgaatgtggtggcagcgttgtacagaacccagggcca
gagacttactgtgttattgtaggagctgagaatgtcagagtgaaaaacattattgcttcc
aacaaatacgatgtagtgagggcagagtggcttcttcagtgttttcaaaccaaaatgctt
gtgccttggcaaccagcctttatgattcacatgtctcctgacaccaaagaacattttgct
cgtgagtatgattgttacggagacagctacacggcagacacagatgttgcacaactcaag
gaagtgttctcaagaatgaaagacaatgaggtgatgccttctgacatgatcgcagagtta
gaagaacgttattcgtggaacagctgtcggctcagtatattcagaggaaacactatttat
gtggactgttatgctgttgttaatgagcccagaaccaaaatccagggaactacactgtca
attagagctttggagctccgtttttatggtgcaatagtagtctctcaccttgaagagggc
atctcccatgttgttgtaggagatgatcgttcccgggtaaaagagatgaaatcactcaga
agaacatttgggataaaatttaaaatcgtgtctgagctgtgggtaactgagtcagtggag
gaaggagtcctaaagaatgaaaatcagtacttaatctaa

DBGET integrated database retrieval system