KEGG   Columba livia (rock pigeon): 102093871Help
Entry
102093871         CDS       T02912                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00020  Citrate cycle (TCA cycle)
clv00190  Oxidative phosphorylation
clv01100  Metabolic pathways
clv01200  Carbon metabolism
Module
clv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
clv_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102093871 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102093871 (SDHA)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102093871 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 102093871
NCBI-ProteinID: XP_021153490
LinkDB All DBs
Position
Unknown
AA seq 700 aa AA seqDB search
MLADATPQTLQLTLLCSAAPASPPAQRRPGAIGPQKCGKSSSWKHLFYDSCLDFFPQWPA
ACQTLARNLHFTVHGKKNASTKVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAG
FNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHFYDTVKGSDWLGDQDAIHYMTE
QAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHTL
YGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGTIHRFKAKNTVIATGGYGRTYF
SCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGE
RFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHVFLQLHHLPPQQLATRLPGIS
ETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVNGQDKVVPGLYACGEAACA
SVHGANRLGANSLLDLVVFGRACALTIAETCKPGEPIPSIKPNAGEESVANLDKLRFANG
TIRTSEVRLNMQKTMQNHAAVFRTGSVLQEGCEKISQIYGDLAHLKTFDRGIVWNTDLVE
TLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRVDEFDYSKPLQGQQQKPFEQHWRK
HTLSYVDVPSGKVTLKYRPVIDRTLNEEDCSTVPPAIRSY
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgttagctgatgccaccccccaaaccctccagctcactctgctctgctctgcagccccc
gcctcaccaccagcccagcgccggcccggggcgatcgggccccagaaatgcgggaagtct
tcctcgtggaaacatttgttctatgacagttgtcttgacttctttccgcagtggccagca
gcatgccagactctcgcacgcaacttgcacttcacagtccatggaaagaaaaatgcttct
acaaaggtttctgattcgatttccacacaatatccagtagtggaccatgaattcgatgca
gttgttgtgggtgcaggaggagcaggtctgcgggctgcgtttggtttgtcagaggctgga
tttaatacagcatgtgttacaaagctgtttcccaccagatctcatactgttgctgcacag
ggaggaatcaatgctgctctgggaaatatggaggacgataactggaggtggcatttctat
gacacagtgaaggggtctgactggctgggtgaccaggatgccatacactacatgaccgag
caagcccccgctgcggtgatagagctggaaaattatgggatgccgttcagcagaacggaa
gaaggaaaaatctatcagcgtgcatttggtggccagagtcttcagtttggaaaaggagga
caggctcacagatgctgttgtgttgcagacaggacaggacactcactgttacatactctg
tatggcaggtctctaagatatgatacaagctactttgttgagtattttgccttggaccta
ctgatggaaaatggagaatgtcgtggtgttattgccctttgcattgaagatggcactata
catcgctttaaagcaaagaacactgtcattgccactggtgggtacggccgcacttacttc
agttgtacatctgctcatactagtacgggtgatggcactgctatggtcacacgagctggt
cttccttgccaggacttagaatttgtacagtttcaccctacaggtatctatggggctggc
tgccttataacggaaggatgtcgtggagagggaggtattctaattaacagtcaaggtgaa
agatttatggagagatacgctcctgttgctaaggatctggcttccagggatgtagtatct
cgttctatgaccatagaaatccgtgaaggaaggggttgtggtcctgaaaaagaccacgtg
ttcttgcagttacaccacttaccaccacagcagctagcaacccgtctcccaggaatttca
gaaacagcaatgatatttgctggagttgatgtcactaaagagcctattcctgttctgcca
actgtgcattataatatgggaggtattcctactaactacaaagggcaggtgattacacat
gtgaatggtcaggataaagtggtacctggtttatatgcttgtggggaagcagcctgtgca
tctgtccatggcgcaaatcgacttggagcaaactcacttctggatctggtggtctttggt
cgtgcttgtgcccttactattgcagagacgtgcaagcctggagagccaattccctccatt
aaaccaaatgctggtgaagaatcagttgctaatcttgacaaattaagatttgctaatgga
accataagaacttcagaagtgcgacttaacatgcagaagacaatgcaaaaccacgctgct
gtatttcgtactggttctgtactccaagaaggctgcgagaaaattagccaaatttatggt
gatctggctcatctaaagacatttgatagaggtattgtgtggaacactgacttggtggag
actcttgaactgcagaacctgatgctttgtgctctacaaaccatttatggtgctgaggct
cgcaaagagtcccggggtgctcatgcaagagaggactataaggtacgggtagatgagttt
gactattctaagccactccaaggccaacaacagaagccatttgaacaacactggaggaag
cacaccctttcgtatgtggatgtcccatctgggaaggttactttgaaatacagacctgtg
atcgacagaactttgaatgaagaagactgctccactgtcccacctgctattcgctcatac
tag

DBGET integrated database retrieval system