KEGG   Columba livia (rock pigeon): 102094371
Entry
102094371         CDS       T02912                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102094371 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102094371 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:clv04052]
    102094371 (KITLG)
Cytokines and growth factors [BR:clv04052]
 Growth factors
  Growth factors (RTK binding)
   102094371 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 102094371
NCBI-ProteinID: XP_021151296
LinkDB
Position
Unknown
AA seq 295 aa
MKNIAKFAFCSSSVLTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPND
YMITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISDMTDVLSNYSIINNLTRI
INDLMACLAFDKNKDFVKENGHLYEEGRFIPEDFFRHFNNTIEVYKEFADTLDKNDCILP
STVETPENDSRVAVTKTFLFPPVAASSLRNDSIGSNTSSNKEAVGFISGSSLQGISIALT
SLLSLLIGFILGAVYWKKIHPKSRPESDETTQCHDCQEENEISVLQQKEKEHLQV
NT seq 888 nt   +upstreamnt  +downstreamnt
atgaagaatattgcaaagtttgccttttgctcttcttcggtactgacttggattatcact
tgcttttgtcttcaactactcctacttaatcctcttgtcaaagcccagagttcctgtggg
aatccagtgacagatgatgtgaatgacattgcaaaactggtcggaaatctcccaaatgat
tatatgataacccttaaatatgtcccgaagatggatagtctgcctaatcactgttggttg
catttgatggttcctgaattttcaaggagtctacataatcttctccagaagttttcagat
atttcagatatgactgatgttttaagcaactattcaatcatcaataatctcacaaggata
attaatgatcttatggcatgtctagcttttgataaaaataaggattttgtaaaagaaaat
ggtcacctttatgaagaaggtcgtttcattcctgaggatttttttaggcactttaataat
actattgaggtctacaaggagtttgcagatacgctggataagaatgactgcattctgcct
tcaacagtagaaacaccagagaatgattccagagtcgctgtcacaaaaacatttttgttt
cctcctgttgctgccagctcccttaggaatgacagcattggcagtaacactagcagtaac
aaagaggcagttggcttcattagcggctccagcctgcaagggatcagcatagcactgaca
tcattgctgtctcttcttattggctttattttgggagctgtatactggaagaaaatacat
cccaaatccagaccagaaagtgatgaaactacacaatgtcatgactgtcaagaggaaaat
gagataagtgtgttgcagcaaaaagaaaaagaacatctacaagtgtag

DBGET integrated database retrieval system