KEGG   Columba livia (rock pigeon): 102094521
Entry
102094521         CDS       T02912                                 

Gene name
RFWD2
Definition
(RefSeq) E3 ubiquitin-protein ligase RFWD2 isoform X2
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:clv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102094521 (RFWD2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102094521 (RFWD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:clv04121]
    102094521 (RFWD2)
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102094521 (RFWD2)
Ubiquitin system [BR:clv04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102094521 (RFWD2)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     102094521 (RFWD2)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 zf-RING_4 Prok-RING_4 zf_C2H2_10
Other DBs
NCBI-GeneID: 102094521
NCBI-ProteinID: XP_013227670
UniProt: A0A2I0MC58
LinkDB
Position
Unknown
AA seq 644 aa
MCIPQPFLLCVSWARILDNTKPSMSLSILPPGTTWFCTTELEKKLKRTNQPTSPICFDMI
EEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRSEEK
RLKLDHSNGHRWQIIQDLLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEF
LKVARRNKREQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIID
STEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMTRVSDDSRTTS
QLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKV
YEYGTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSK
VYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSS
RYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNV
GKPHCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVL
DKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgtgcatccctcagcctttcctactctgtgttagctgggcaaggatcctggacaacacc
aaaccatcaatgtcactaagcatcctgccccctggcactacttggttctgcactactgaa
ctagaaaagaagttaaaaagaacaaatcaaccaaccagtccaatctgtttcgatatgatt
gaagaagcctacatgacgaaatgtggacacagtttctgctataaatgtattcaccagagc
ttggaggacaataacagatgtcccaaatgcaattatgttgtggacaacatagatcacctt
tatcctaacttcttagttaatgaacttattcttaaacagaagcaaagatctgaggagaaa
agactcaaactggaccattcaaatggccacaggtggcagataattcaagatttgttggga
actgatcaagacaatcttgacttggccaatgtcaacctgatgctggagctgctggtgcaa
aagaagaagcagttggaagcagagtcccatgctgcccaattgcagatccttatggagttt
ctcaaagttgcaagaagaaacaaaagagagcaattggagcagatccagaaggagctaagt
gttctggaagaagatattaaacgagtagaggaaatgagtggtttgtactccccggtcagc
gaggacagcacggtgccgcagttcgaggctccctccccttcacacagtagtattattgac
tccacggaatacagccagcctccaggcttcagtggcagttcccagaccaaaaagcagccg
tggtataacagcacgctggcctcgcggcgcaaacggctcacagctcattttgaggacctg
gagcagtgctatttttccaccaggatgactcgtgtctcggatgacagcaggaccacaagc
cagctggatgagtttcaggagtgtctgtccaagttcacacgctacaattctgtccgaccc
ctggccacgctgtcttatgccagcgacctctacaatggctccagcatagtgtccagtatc
gagttcgaccgagactgtgactactttgccatcgccggggtgacaaagaagattaaagtc
tatgagtatggtacagtcattcaggacgcggtggatattcactaccctgagaatgaaatg
acctgtaattccaaaatcagctgtatcagctggagtagttaccacaagaacctgctagcc
agcagtgactatgaaggcaccgtcatcctttgggatggattcacgggacaaagatccaag
gtctaccaggagcatgagaaaaggtgctggagtgttgactttaacttgatggacccaaag
ctattggcttcaggctctgatgatgccaaagtgaagctgtggtctaccaacctggacaac
tcggtagcaagcattgaggccaaggctaacgtgtgttgtgtcaaattcagcccctcttcc
aggtatcacctagcttttggctgtgcagatcactgtgttcactactacgatcttcgcaac
actaagcagccgatcatggtgttcaaagggcatcgcaaggcagtctcctacgcaaaattt
gtgagcggggaagaaattgtctctgcgtcaacagacagtcagctgaagctgtggaacgta
gggaagccccactgcttgcgctccttcaagggtcacatcaacgagaagaatttcgtaggg
ctcgcatccaacggagactacattgcctgcggaagcgaaaataattccctttacctatac
tataagggcctctcaaagacactgctgacattcaagtttgatacagtcaaaagcgtcctg
gacaaggaccgtaaagaagatgacacaaacgagtttgtgagtgctgtgtgctggagggca
ctaccagatggggagtccaatgtgctgattgctgctaacagtcagggtacaattaaggta
ctggagctggtatga

DBGET integrated database retrieval system