KEGG   Columba livia (rock pigeon): 102094606
Entry
102094606         CDS       T02912                                 

Gene name
EI24
Definition
(RefSeq) etoposide-induced protein 2.4 homolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102094606 (EI24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 102094606
NCBI-ProteinID: XP_005509213
UniProt: A0A2I0LS98
LinkDB
Position
Unknown
AA seq 330 aa
MADSVKTFLHDLVRGIKDSVWGICTISKLDARIQQKREEQRRRRANSALAQRRFHLEERK
QENEPRIVSRIFQCCAWNGGVFWLSLFLFYRVFIPVLQSVTAQIIGDPSLHGDVWAWLEF
LLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLL
QALFLIQGMIVSLFPIDVVGQLISLLHMSLLYSLYCFEYRWFNKGLEMHQRLSNIERNWP
YYFGFGLPLAFLTATQSSYIVSGCLFSILFPLFIISANEARTPGKTYHFQLRLFSLVVFL
SNRLFHKTVYLQSALGAASSSSSSSPAKHT
NT seq 993 nt   +upstreamnt  +downstreamnt
atggcggacagcgtgaaaaccttcctgcacgacctcgtcaggggaatcaaggattccgtc
tggggcatctgcaccatctcgaaactggacgcgcggatccagcagaagagggaagagcag
cggcggcggcgagcgaacagcgcgctcgcccagcgcaggtttcacctggaagagcgcaag
caagaaaatgaaccccggatagtgagccggatatttcagtgctgtgcctggaacggaggc
gtgttttggcttagtctcttcttgttttaccgcgtatttatccccgttctccagtcggtg
acggcacagatcattggtgacccatccctgcacggcgacgtctgggcctggctggaattc
ctcctcacctccatcttcagcgcgctctgggtcctgccgctcttcgtgctcagcaaagtc
gtcaatgccatctggttccaggacattgcagatctagcgttcgaagtctcgggcaggaag
cctcaccccttccccagcgtcagcaagatcatcgccgacatgctgttcaacctcctcctg
caggcgcttttcctcatccaggggatgatcgtcagcctgttccccatcgacgtggtgggg
cagctcatcagcctcctgcacatgtcgctgctctactcgctctactgcttcgagtaccgc
tggttcaacaaaggcctggagatgcaccagcgcttgtccaacatcgagaggaactggccc
tactacttcgggttcgggctgccgctggcgttcctcaccgccacgcagtcctcctacatc
gtcagcggttgcctcttctccatcctcttccccctcttcatcatcagcgccaacgaagcc
agaacccccggcaaaacctaccacttccagctccgtctcttctccttggtggttttcctg
agcaaccggctcttccacaaaactgtttacctgcagtcggccctgggcgctgcttcctcc
tcctcctcctcctcccctgccaaacacacctga

KEGG   Columba livia (rock pigeon): 102098853
Entry
102098853         CDS       T02912                                 

Gene name
TP53I3
Definition
(RefSeq) quinone oxidoreductase PIG3 isoform X1
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102098853 (TP53I3)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     102098853 (TP53I3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N
Other DBs
NCBI-GeneID: 102098853
NCBI-ProteinID: XP_005510166
UniProt: A0A2I0MV14
LinkDB
Position
Unknown
AA seq 351 aa
MAQSAESAGSAGRNNDKMLAAYFDCPGGPENLYVKEVIKPHPGEGEVLVKVSASALNRAD
LLQRRGKYPPPKGASDILGLEAAGSVVGLGPGCKGRWKIGDAVMALLSGGGQAEYVTAPE
GHLMPVPGGMTFVQAAAIPEAWLTAFQLLRFVGKVEEGERVLIHAGASGVGLAAIQLVRL
AKAIPIVTAGTQEKLKATANAGAAAGFNYKNEDFSEKVLAFTQGSGVDLILDCVGGSYWE
KNLACLSTDGRWIVYGLLSGGEVHGDLFARLLSKRASIHTSLLRSRDKEYKERLVKAFTE
EVLPHFSEGTSPRLQPFVDSVHSLHEIAETHRVMEENKNIGKIVIEMPASS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggctcaatctgcagaatcagccggatccgcaggtagaaataacgataaaatgttggca
gcctatttcgattgcccaggaggcccagaaaatctgtatgtgaaagaagtgataaaacca
catccaggagaaggagaagttctcgtgaaggtctctgccagcgctctgaatagggctgat
ttactccagaggagagggaaatatcctccccccaaaggagcaagtgatattttaggctta
gaagcagctgggagtgtggttgggctcggacctggctgcaagggccggtggaagatcggc
gatgcggtgatggctctgctctccggcggtggccaggcggaatatgtcacagcacccgaa
ggccacctgatgccagttcccgggggtatgacatttgttcaggctgcagccatccccgaa
gcctggctaaccgccttccagttgctgcgttttgtaggtaaagtagaggagggcgagcga
gtgttgatccacgctggagcgagcggagttggcctggcagccattcagctggtgaggctg
gcaaaagcgattcccatcgtgacagcagggactcaagagaaactgaaagcgacagcgaac
gccggagcagctgcggggttcaactacaagaatgaagattttagtgaaaaggtcttggcg
ttcacccaaggttccggagtagatctgattttagattgcgttggtggctcatactgggag
aagaatcttgcctgtctgagcactgacggccggtggattgtttatggactgctgagtgga
ggtgaagtacacggagatttgtttgccaggctgctttccaaaagagcgagcatccataca
agtctgttgcgatcacgagacaaggagtataaggaacggctggtgaaagccttcacagaa
gaggtgctgccacatttttctgaaggaacctcccctcgtctccaaccgtttgtcgacagc
gttcactctcttcatgagattgcagagacacacagggtcatggaagaaaacaagaacatt
ggcaaaattgtcatcgaaatgcctgcttcatcttaa

DBGET integrated database retrieval system