KEGG   Columba livia (rock pigeon): 102094994
Entry
102094994         CDS       T02912                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10A
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04060  Cytokine-cytokine receptor interaction
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv04217  Necroptosis
clv05132  Salmonella infection
clv05164  Influenza A
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102094994
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102094994
   04217 Necroptosis
    102094994
   04115 p53 signaling pathway
    102094994
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102094994
  09172 Infectious disease: viral
   05164 Influenza A
    102094994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:clv04050]
    102094994
   04090 CD molecules [BR:clv04090]
    102094994
Cytokine receptors [BR:clv04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102094994
CD molecules [BR:clv04090]
 Proteins
  102094994
SSDB
Motif
Pfam: Death TNFR_c6 Tweety
Other DBs
NCBI-GeneID: 102094994
NCBI-ProteinID: XP_021136581
LinkDB
Position
Unknown
AA seq 453 aa
MRRALRTSLPRRCLPLLPLLPQEFALGTAAAPVNRRDLSDPSTGRRYFYQVQDSDRYCKM
CPAGTYVTEHCVEPNGTSKCLPCNKSEYIEYPNGFHRSRTRRTELTAASYSAAESDLVCS
RLVGQLGVVSHFNEGRGRRSVAGLGLEPPLLSPADQVELSPCRADRNTQCACKPGTFCSP
DHSCEMCQKCRPRCPQGEVELAPCTPHSDRQCGPPTGTSSGLSNTLIAVISVLVVIGCVL
LLVLFYICHRCCSSGDGRDLSGKSCSVMDYLVRQLPCSQRGGLGTQDNIHNEEVSRDRLL
DLNSGSVTPRAPELEEVMPRTSYTDVKPRRKLVSVPGEDPVNRKCRGAENVLNGGDFFPS
IPLVLLFENVLWKDWKRYGRALGLLENEIAFAMNEPFTQEPFYQMLNTWQNKQGMNASVN
TLLETLHEINLSGTAEDIASKLVQKGLFQYEAS
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgcgccgggcgctgcgcacctccctcccccggcgctgcctcccgctgctgccgctgctc
ccgcaggaatttgctctcggaactgctgcagcaccagtgaataggagggatctctcagac
ccaagcacgggacggagatacttttaccaagtccaagacagtgatcgctattgcaagatg
tgccccgcgggcacctacgttacagaacactgtgtagagcccaatggcaccagcaagtgt
ttgccatgtaacaagagtgaatacatcgaatacccgaatgggtttcacaggtcaaggacc
aggaggactgagctcacagcagcatcatattctgcagcagagagtgacttggtctgctcc
aggcttgtgggtcagctcggggttgttagccactttaacgaaggaagggggcggaggagc
gtggcggggctgggcttagagccacctctcctctcgcccgcagaccaggtggagctgagt
ccctgccgagccgaccgcaacacccaatgtgcctgcaagcccggcaccttctgctccccg
gaccattcctgcgagatgtgccagaagtgccggccccggtgtccccagggcgaggtggag
ctggctccctgcaccccgcacagcgaccgccagtgtggtccccccactggcacctcctcc
ggcttatccaataccttgattgcagtcatctccgtcctggtggtaattgggtgtgttttg
ttgctcgttttattctacatatgccaccgctgctgttcctcaggagacggcagagacctg
agcgggaagtcgtgcagcgtcatggactacctggtgcggcagctgccgtgtagccagagg
ggtggcctggggacacaggacaacatccacaatgaggaggtctctcgggatcggctgctt
gacctgaattcgggttcagtgacacccagagccccggagctggaggaggtgatgccaagg
acctcgtataccgatgtgaaacccaggaggaaactggtttcagtgccaggagaagacccc
gttaaccgtaagtgtaggggtgcagagaatgtgctgaatgggggtgactttttcccttcc
atccctctagttttgctttttgaaaacgtgctctggaaggactggaaaagatacggccga
gcccttggtctgctggagaatgaaattgccttcgcgatgaatgagccgttcacgcaggag
cccttttaccagatgctcaacacgtggcagaacaaacaggggatgaacgcgtctgtgaac
acgctgctggagacgctgcacgagatcaacctcagcgggactgcagaggacatcgcctcc
aaactggtccagaaggggttgttccaatacgaagcgagctga

KEGG   Columba livia (rock pigeon): 102095613
Entry
102095613         CDS       T02912                                 

Definition
(RefSeq) uncharacterized protein LOC102095613
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04060  Cytokine-cytokine receptor interaction
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv04217  Necroptosis
clv05132  Salmonella infection
clv05164  Influenza A
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102095613
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102095613
   04217 Necroptosis
    102095613
   04115 p53 signaling pathway
    102095613
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102095613
  09172 Infectious disease: viral
   05164 Influenza A
    102095613
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:clv04050]
    102095613
   04090 CD molecules [BR:clv04090]
    102095613
Cytokine receptors [BR:clv04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102095613
CD molecules [BR:clv04090]
 Proteins
  102095613
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 102095613
NCBI-ProteinID: XP_005499409
LinkDB
Position
Unknown
AA seq 416 aa
MGAGGVAGLLVTLLIVPGTGAEGCGEGEYLHEGRCCVFCPAGTYVDQHCSAPHLRGTCLP
CIEGESYTAHENGLEECLLCRQCKDDQITLRPCTLMRDTECQCKPGYFCPAEGCEVCQRC
STVYPEGKETVQNCNATTGLGYDLPDQGSTALVWSIVIGLGCGVLVLVFVIRKLKSDKAP
STVKDVEKGLELEGSTESLILPEVEAPANKAAKAEGENSGESPEGQAQTNVNLEVNNTSP
EENGGVLSERAAILRGGLRRHMGRFWRRIAMSSLPAKTGHNPGFHQNARSNIQSSRMPAN
HMAREPKFRIIVKDLSQKELRDSFWAFINEVPPNKWKRLMRTHLQENDITKIIYDFPKDR
EEQYYQMLLTWKNTLGEKRCIIKLLDELRYLDTKAYDNILNTLKSNNVITKVEATD
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgggagccggaggggtggcagggctgctggttaccctgctgatagtgcctggaaccgga
gcagagggctgtggggagggagaatacttacacgaaggtcgctgctgtgtgttttgtcct
gcaggtacttacgttgatcagcactgcagcgctccgcatttgagaggaacatgcctccct
tgcatcgaaggagaaagttatactgctcatgagaatggcttggaagaatgcttgttgtgc
agacagtgcaaagatgatcagataactttgagaccctgtactctgatgcgtgatactgaa
tgccagtgcaaaccagggtatttctgccctgctgagggctgtgaagtatgtcagagatgc
agtacagtgtatccggaagggaaagaaactgtgcagaattgcaatgctactactggccta
ggatatgacttacctgatcaaggaagcacagctcttgtgtggagtattgtgattggtttg
ggttgtggtgttctggtgctggtttttgtcattagaaagctgaagagtgataaagctcct
tcaactgttaaagatgtggagaaaggtctggagttggagggcagtactgaaagcctcatt
ttaccagaagtggaggcacctgcaaataaggcagccaaggcagagggtgagaactctggt
gagagcccagagggccaagcacaaaccaacgttaacttggaagtgaataacacatcacca
gaggaaaatggtggtgtgctttctgagcgggctgccatcctgcgtgggggcttgaggcgc
cacatgggcaggttctggaggaggatcgctatgtcttcactaccggcaaaaactggacac
aatcctggttttcatcagaacgcccggtctaacatacaaagcagcaggatgccagcaaat
catatggcacgagaaccaaagtttcgaataattgttaaagatctctctcaaaaagagctg
agagatagcttttgggcctttataaatgaagtaccaccaaacaaatggaagcggcttatg
agaactcatctacaggaaaatgatattactaaaattatttatgactttcctaaagataga
gaagaacagtattatcagatgcttctcacttggaaaaacacactgggagaaaaacgatgt
attattaaattactggatgagttaaggtatctagataccaaggcttatgataacatattg
aacactttaaaaagtaataacgttataactaaagtagaagctacagattaa

DBGET integrated database retrieval system