KEGG   Columba livia (rock pigeon): 102095010
Entry
102095010         CDS       T02912                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04020  Calcium signaling pathway
clv04260  Cardiac muscle contraction
clv04261  Adrenergic signaling in cardiomyocytes
clv04270  Vascular smooth muscle contraction
clv04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102095010 (CACNA1C)
   04020 Calcium signaling pathway
    102095010 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102095010 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102095010 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102095010 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102095010 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:clv04040]
    102095010 (CACNA1C)
Ion channels [BR:clv04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102095010 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102095010
NCBI-ProteinID: XP_021140389
LinkDB
Position
Unknown
AA seq 2221 aa
MFQALVRQAYHPLPSHQPGEPETKYKGKLVHETQLNCFYIKPGGSNYGSPRPAHANMNAN
AAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQKKQG
TTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSN
ATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILE
QATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIAL
LVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTEC
KAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENE
DEGIDEEKPRNMSMPTSETESVNTDNVPGADMEGENCGARLAHRISKSKFSRYWRRWNRF
CRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEML
LKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITR
YWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNF
PQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNCILXCYVFLQV
GLNNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKTAVEEETKEEKIELKSITA
DGESPPATKINMDDYQPNENEEKSPYPTTEATAEEDEEEPEMPVGPRPRPMSELHLKEKA
VPMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSFRNQ
ILFYFDIVFTVIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNI
LDLLVVSVSLISFGIQSNAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN
IVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTAAECRGYYITYKDGEVNQPMIQPRSW
ENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYII
IIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYK
VWYVVNSTYFEYLMFVFMQVNTICAIFQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLI
AFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEV
NPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYV
ALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIML
ACLPDKKCDPESEPANSTEADNSCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLT
RDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRL
VSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQ
VVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGP
EIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFT
TQRPLHINKSGNNQGDTESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPS
YPSTVSTVEGHGTPLSPTIRVQEAPWKLPSKRTHYYETLGRSSSRDSQLAIVCQEEVSQD
ETYDENLNEDIEYCSEPSLLSTEMLAYQDDENRQLTPPENNKGEDTRHSPKKGFLCSSAL
GRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTMFSRLCA
TPPATPCSRGWPQQTIPTLRLDRAESSEKLNSSFPSVHCGSRYPDDTGSSSPRRARPVSL
TVPSQSGGSSRQFHGSAGSLVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMEN
AADNILNGNSKQSPNGNLLPFANCRDPGQDSAGEEEEEVQNPDCRKSQEELKDSRIYISS
L
NT seq 6666 nt   +upstreamnt  +downstreamnt
atgtttcaagccttagttcggcaagcctatcaccctctacccagccaccagccaggggaa
cccgaaacaaagtacaaggggaagctggtgcatgaaactcagcttaactgcttctacatc
aaacctggaggttccaactatgggagtccccgtccagctcatgccaacatgaatgccaat
gcagctgcagggcttgccccagagcatatccctactccaggggcagctctctcctggcaa
gctgcgattgatgctgccaggcaagccaaactgatgggtagtgctggcaatgcaacaata
tccacagctagctccacgcagagaaaacggcagcagtatgggaaacagaaaaaacagggt
accaccacagctacgcgtcctccccgggcactgctgtgtttaacactgaaaaatcccatc
cggagggcgtgcatcagcatcgtcgaatggaaaccatttgaaataattattttactgact
atatttgccaattgtgtggccttagctatctatatcccctttccagaagatgattccaat
gccaccaattccaatctggaacgagtggaatatctctttctcataatttttacagtggaa
gcatttttaaaagtaatagcatatggacttctctttcaccccaacgcttacctccgcaat
ggctggaatttactagattttataattgtggtagtagggctttttagtgcaattttagaa
caagcaaccaaagcagatggggggaattcaataggaggaaaaggtgccggatttgatgtt
aaagcactgcgggctttccgagtattacgtccattacggctggtgtctggagttcctagt
ctccaggtggttttaaattcaattatcaaggccatggtccctttgttgcatattgccctg
ctggtgctgtttgtcattattatctatgccatcattggactggagttattcatggggaag
atgcacaagacctgctaccatgtgcaaggaggattgatagatacgccagcagaagacgac
ccgtctccgtgtgccccccagtctgcgcacgggcggcagtgtcagaacggcaccgagtgc
aaggcgggctgggagggacctaagcacggcattaccaactttgacaattttgcttttgcc
atgctgactgtgtttcaatgcatcacgatggagggctggacagatgtactgtactgggtc
aatgatgccataggaagggactggccctggatctattttgttacactaatcatcataggg
tcattttttgtacttaacttggttctcggtgtacttagcggggagttttccaaagaaaga
gagaaggctaaggctcggggcgatttccagaagttacgggaaaagcaacagctagaggag
gatttgaagggatacttagactggataacccaagcagaagatattgacccagaaaatgaa
gatgaaggcattgatgaggagaagcctcgaaacatgagcatgcccaccagtgagaccgag
tccgtgaacacagacaacgttcctggagcagatatggaaggcgaaaactgcggtgctagg
ctagcgcatcggatctcaaaatcaaagtttagtcgttactggcgccgctggaatcgattc
tgcagaagaaagtgccgcgctgccgtcaagtccaatgttttctactggttggtgatcttc
cttgtgtttctcaacacccttaccattgcctctgaacactacaaccagccagactggctc
acagaggtccaagacactgccaataaggtgttgctagctcttttcacggcagagatgctg
ctgaagatgtacagccttggtctccaggcctattttgtgtccctcttcaaccgctttgac
tgtttcattgtgtgtggaggaatcctggaaacgatcctggttgagacaaagatcatgtca
ccactgggcatctcggtgttgagatgtgttcgactcctaagaatatttaaaatcacaaga
tactggaactccctgagtaaccttgtggcttcactcctgaattcagtccgctccattgcc
tccttgttgctgcttcttttcctcttcattatcatcttctcactcctggggatgcagctc
tttgggggcaagtttaactttgatgagatgcagactaggaggagtacatttgacaacttc
ccccagtccctcctcactgtgtttcagatcctgactggggaggactggaattcggtgatg
tatgatgggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttac
ttcatcatcctcttcatctgtggaaactgtatcctttgatgctacgtttttctccaagtg
gggctaaataaccttgctgatgctgagagtttaacatctgcacagaaagaggaggaagag
gaaaaagaaaggaaaaagctagcgaggactgctagtcctgaaaagaaacaggagatagaa
aaaacagctgtggaggaggagacaaaggaggagaaaattgagctgaaatcaatcactgct
gatggagaatccccgcctgctaccaagatcaacatggatgattatcagcccaatgaaaac
gaagaaaagagcccatatcccacaacagaagctacagcagaggaagatgaggaagaaccc
gagatgcctgtcggccctcggcctcgcccgatgtctgagctgcacctcaaggaaaaggct
gtgcctatgcctgatgccagcgcttttttcatcttcagtcctaacaacaggtttcgtgtc
cactgccatcgaatcgttaacgataacattttcaccaacctgatcctatttttcatcttg
ctcagcagcatctccctggcagctgaggaccccgtccgccacctctcctttaggaaccaa
attcttttttattttgatatagtttttactgtcattttcaccattgaaattgctctgaag
atcctaggcaatgcagactatgtcttcactagtatctttacattagaaattattcttaag
atgaccgcatacggggctttcctccataagggttccttctgcagaaactatttcaacatc
ttagacctgctggtggtcagcgtttctctcatctcctttgggatccagtccaatgccatc
aatgtggtgaagatcctgcgtgttctgcgagtccttagaccactgagggccatcaacaga
gccaagggactaaagcatgtggtccagtgtgtgtttgtcgccattcgaaccatcggaaac
attgtaatcgtcaccactttgctgcagttcatgtttgcctgcattggagttcagttgttt
aagggcaagctgtacagctgcactgatagctccaagcagacagcagcagaatgcagagga
tactacattacatacaaggatggtgaggtcaaccagccaatgatacaacctcgtagctgg
gagaacagcaagtttgacttcgacaatgtcttgactgccatgatggccctcttcactgtc
tcaacctttgagggatggccagagttgctgtataggtccattgattcccacatggaggat
gtgggacccatctataatcacagggttgagatctccatcttctttattatctacatcatc
atcattgctttcttcatgatgaacatcttcgttggtttcgtcatcgtcacatttcaggaa
caaggagaacaagagtacaagaactgtgagctggacaaaaaccagcgccagtgtgtagaa
tatgccctgaaggcccggcccctccggagatacatccctaaaaaccagtaccagtacaaa
gtttggtatgtggtcaactccacctattttgaatacctgatgttcgtttttatgcaagta
aacactatttgtgctatttttcagcactacggtcagagctgcatgttcaaggaagccatg
aacatcctcaatatgctcttcactggcctcttcactgttgagatggtcctgaaattaatc
gccttcaaacccaagggttactttagtgatccttggaatgtttttgacttcctcatcgta
attggcagcattatagacgtcattctcagtgaaactaatcactatttctgtgatgcatgg
aatacatttgacgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtg
aacccagctgaacatacccaatgttcttcctctatgaacgcagaggaaaactctcgcatc
tcaatcaccttcttccgactcttccgcgtgatgcgtcttgtgaagctcctgagccgaggg
gagggcatccggacgctgctttggaccttcatcaagtccttccaggctctcccctatgtg
gctctcttaatagtgatgttgttcttcatctacgccgtgatcggaatgcaggtgtttggt
aaaattgcgctgaatgataccacagaaatcaaccgcaacaacaacttccagaccttcccc
caggcagtgctgctgcttttcaggtgtgccaccggtgaggcctggcaagaaatcatgctg
gcgtgtctcccagacaagaagtgtgacccagagtcggagccggccaactccaccgaagcc
gataactcctgtggcagcagcttcgctgtcttctatttcatcagcttctacatgctctgt
gccttcctgatcatcaatctttttgtagctgttataatggataactttgattacctgaca
cgggactggtccattttaggaccacaccacctggatgagtttaaaaggatctgggcagag
tatgaccctgaagccaagggacggatcaaacacttggacgtggtgaccctgctccggcga
atccagcccccactgggctttgggaagctctgccctcaccgggtggcttgcaaacgtctt
gtctccatgaatatgccactgaacagtgatgggactgtcatgttcaatgccactctcttt
gcattagtcagaacagcactgaggatcaagacagaaggtaacctggagcaagccaatgaa
gagctgagggcaataattaagaaaatctggaagcgcactagtatgaagctgctggaccag
gtggtgcccccggcaggtgatgacgaggtgactgttgggaagttctacgccactttcctg
attcaagagtatttccgaaagttcaagaaacgtaaagaacagggcctggtgggcaagccc
tcccagcgcaacgctctctccttgcaggctggtctgcgcacacttcacgacattgggcca
gagatccgacgagcaatttctggagaccttacagctgaagaagagctggataaggccatg
aaagaagctgtttctgctgcctctgaagatgatatcttccggagagctggaggcttgttt
ggaaaccatgtcagctattaccaaagtgatggcaggagtgcgttcccccagacattcacc
acccagcgacctttgcacatcaataagtctggcaacaaccaaggcgataccgagtctcca
tctcatgagaagttggtggactccaccttcactcccagcagctactcatcttcaggctcc
aatgccaacatcaacaatgccaacaacactgccctgtgccgcttccccagcccacccagc
taccccagcactgtcagcacagtggaaggccacggaacccccttgtcacccaccatacgt
gtgcaggaggctccttggaaactaccttccaaaaggacgcattactacgaaacactggga
cgctccagttccagagacagccagctggcaattgtttgccaagaggaagtgtctcaggat
gagacttatgatgaaaatttgaatgaagacattgagtactgtagtgaaccaagtctgctc
tctaccgaaatgcttgcataccaagatgatgaaaacagacaactcactccaccagaaaac
aacaaaggagaggacacccggcactctccgaagaaagggtttctgtgctcctcggcacta
ggtcgaagagcatcttttcacttagagtgtctgaaaagacagaaaaaccagggcgtagat
gtctcgcagaagacagttctgcctttgcatctggtacaccatcaggcgttagcagtggcc
ggcctgagtcccctcctccagcgaagccattcccccaccatgttttctcggctgtgtgct
acaccccctgcaaccccctgcagccgtggctggccgcaacagaccatcccgactctgcgt
ctcgacagggcagagtccagcgagaagctcaacagcagtttcccgtcagttcactgcggc
tctcggtacccggatgacaccggctccagcagcccgaggagagccaggccggtctccctc
actgtccccagccagagcggagggagcagcaggcagtttcacggcagcgcgggcagcctg
gttgaagcggtcttgatttcggaaggactgatgcagtttgctcaagatccaaagttcatt
gaggtcacaacccaggagcttgcagatgcctgtgacatgacgatagaagagatggaaaat
gcagcagacaacattctcaatggtaacagcaagcagagccccaatggcaacctcttgcct
tttgctaactgcagggacccagggcaggacagtgcaggagaggaagaggaagaggtgcag
aacccggattgtagaaaaagtcaggaggagctcaaggacagcaggatttatatcagcagc
ctgtag

DBGET integrated database retrieval system