KEGG   Columba livia (rock pigeon): 102095030
Entry
102095030         CDS       T02912                                 

Gene name
STEAP3
Definition
(RefSeq) metalloreductase STEAP3 isoform X1
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102095030 (STEAP3)
   04115 p53 signaling pathway
    102095030 (STEAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clv04131]
    102095030 (STEAP3)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     102095030 (STEAP3)
Membrane trafficking [BR:clv04131]
 Exocytosis
  Others
   Others
    102095030 (STEAP3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct NAD_binding_2 2-Hacid_dh_C IlvN Shikimate_DH
Other DBs
NCBI-GeneID: 102095030
NCBI-ProteinID: XP_021146878
LinkDB
Position
Unknown
AA seq 488 aa
MSGGDMAKPLLGHQSMEGDPSIKPAAGRTIGVLGSGDFARSLAIRLVCSGFKVVVGSRNP
KRKAGLFPSAAEVTFQAEAVKKTDVIFVAVFREHYSTLCDLADLLAGKILVDVSNNSEFN
HHKESNAEYLASLFPACTVVKGFNVVSAWTLQSGARDGNKQVLICSNNQEAKRTVAEIAQ
AMGFTPVDMGCISSAREIENIPLRLLPAWKIPIFLALGLFLCFFTYNLIRQVIHPYIREQ
KNKLYKIPIEVVNTTLPCVAYVMLSLVYLPGVLAACSQLYYGTKYRRFPDWLDQWLQHRK
QIGLLSFFCAALHAVYSLCLPMRRSHRYQLIETAVKQAVEKKMNIWVEEEVWRMEIYISV
GIIALGLLSLLAITSLPSIANSLNWREFSFIQSTLGFIALVISTLHTLTYGWSRAFDENQ
YKFYLPPTYTLTLLVPCTVILAKVIFSLPCIQHRLLRIRRGWEKGRYVKFVLPSTTEEYS
SGETSSNV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtctggaggagacatggcaaaacccctcctgggccaccagagcatggagggtgacccc
agcatcaagcctgcagctggccgcaccatcggggtgctggggagcggggacttcgcccgg
tcattggccatccgcctggtgtgctccgggttcaaggtggtggtcggcagccgcaatccg
aagcgcaaagccggcctcttcccttctgcagcagaagtcaccttccaggctgaggcagtg
aagaagacagatgtcatttttgtggcggttttcagggaacactactccaccctctgtgac
ctggctgatctgctggcgggcaagatcctggtggacgttagtaacaactccgagttcaac
catcacaaagaatccaacgccgagtacttggcttccctgttcccagcttgcactgtggtc
aaggggtttaatgtggtttctgcgtggacactgcagtcaggtgccagggatggaaataag
caggttctgatttgctcaaataaccaagaagccaagcgcactgtggcagaaattgctcaa
gccatgggattcacccctgtggacatgggctgcatatcatcagctcgtgagatcgagaac
attcccctgcgcctcttgccggcctggaaaatccccatctttttagctttggggctcttt
ctttgcttcttcacttacaacctgatccggcaggtcatccacccttacatcagggagcag
aagaacaagttatacaagatcccaatcgaggtggtcaacacaacactgccttgtgtggcc
tatgtcatgctgtctctcgtctacctgcccggggtgctggcagcctgctcgcagctctac
tacggcaccaaatacaggcgttttccagattggctcgaccagtggctccagcaccgaaag
cagattgggctcctcagcttcttctgtgcggctttgcacgccgtgtacagcctctgtctg
cccatgcgccgctcccaccgctaccagctaatcgagacagctgtcaagcaggctgtggag
aagaagatgaatatctgggtagaggaggaagtctggaggatggagatttatatctctgtt
ggaataattgccctgggcttgctgtcgttacttgccatcacttcacttccatccatcgca
aactctctcaactggagggaattcagtttcattcagtccacccttggatttattgctttg
gtaatcagcacactgcacacgctgacgtatggatggtcgcgggctttcgatgagaaccag
tacaaattctacctgcccccaacctacaccctcacgctgctcgtcccatgtactgtcatc
ctcgccaaagtcatcttcagcttgccctgcatccagcacagactgctgcgaatcaggagg
ggctgggagaaggggcgatacgtgaagtttgttctgcccagcacaacggaggaatattca
agtggggagacctctagcaatgtctaa

DBGET integrated database retrieval system