KEGG   Columba livia (rock pigeon): 102095053
Entry
102095053         CDS       T02912                                 

Gene name
NR3C1
Definition
(RefSeq) LOW QUALITY PROTEIN: glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102095053 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:clv03000]
    102095053 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:clv03310]
    102095053 (NR3C1)
Transcription factors [BR:clv03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102095053 (NR3C1)
Nuclear receptors [BR:clv03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102095053 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 102095053
NCBI-ProteinID: XP_021156771
LinkDB
Position
Unknown
AA seq 777 aa
MDSKELLNSSDQDETRKNALVSTKGGIVMDFRPPFRGGATVQAPVSASPLPAASQSDSNQ
QPALADFSKGLVNNVPPPDLSKAVSLSMGLYMGETDAKVMGNDLGFSQQGQIGISSGETD
FRLLEESIASLNKSSSLAEDAKGAISSEVPLEPDFAGMAGRNVPLESGTAVQSQVGSNGG
NLKLFSEDQSTLDILQDLELPPVSPGKEPNGSPWRLDPLLDDGGLLSPISADDAFLLEGN
LGEDCKPPILSDTKPKINDRGDLLPSSKMPMPQVKTEKEDFIELCTPGIKQENMGPVYCQ
ANFSGSNLLGTKVSAISIHGVSTSGGQMYHYDLNTPSLSQQQDQKPIFNIIPSLPAGSDN
WNRCQGSGDETLAPLVSLNLSGRPAFSNGYSSPGLRSDVSSSPSTTSATTGPPPKLCLVC
SDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQA
GMNLEARKTKKKIKGLQQAGARDXXXXXXXXXXXXXXXXXXXXXXPQLTPTLVSLLEVIE
PEVLYSGYDSTLPDSSWRILSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYKQSNGNLLCFAPDLIINEQRMNLPCMYEQCKHMLMVARELSRLQVSY
EEYLCMKTLLLLSTIPKEGLKSQSLFEEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHDVVENLLSFCFQTFLDKSMSIEFPEMLAEIISNQIPKYSNGNIKKLLFHQK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggattccaaagaattgcttaactcgtcggatcaagacgaaacaaggaaaaatgcgctc
gtcagtaccaaaggagggatcgtgatggactttcgtccacccttcaggggtggagctact
gtacaagcccccgtgtctgcatcgcctctccccgccgcttcgcagtcggattccaatcag
caacctgctttggctgacttttctaaaggattagtaaacaatgtgcctccgccagacctt
tccaaggcagtgtcgctctcgatgggactctacatgggtgaaacggatgcaaaagtgatg
ggaaacgacctcggattttcgcagcagggccaaatcggcatctcttctggagaaacggac
ttcaggctcctggaagaaagtattgcgagcttgaacaagtcctcgagcctggccgaggac
gccaagggagcaatatcctcagaggtgccgctcgagccggatttcgcaggcatggccggt
cgcaacgtccccttggagtcaggaactgccgtccagagccaggtcggctctaatggtggc
aacttgaaattattctctgaagaccaaagcaccctggatattctccaggacttggaattg
ccgccggtatcgcctggcaaagagcccaatgggagcccgtggaggcttgaccccttgctg
gatgacggtggcttgctgtcccccatctctgcagacgatgcatttctcctggaaggaaac
ctcggtgaagactgcaagcctcctattttatctgacactaaacctaaaattaatgaccgt
ggtgaccttttacccagttccaaaatgccaatgcctcaagtgaaaacagaaaaggaagac
ttcattgaactctgtactcctggcataaagcaagaaaacatgggcccagtttattgtcag
gcaaacttctccgggtcgaacctgctgggtactaaagtctctgccatatctatccatggc
gtcagtacctctgggggacagatgtatcactatgatttaaatactccatcgctctctcag
cagcaggatcagaaaccaatttttaatatcattccgtctcttcctgctggatcagacaat
tggaatagatgccagggatcgggggacgagacgctggctcctttggtgtcgctcaacctt
tctggcagacctgctttctctaatggctattcaagccccggactgaggtcagacgtaagc
tcttctccatccacaacgtcggcgacgacgggaccacctcccaagctctgcctggtgtgc
tccgacgaggcctccggctgccactacggcgtcctgacctgcggcagctgcaaagtcttc
ttcaaaagagccgtggaagggcagcacaactacctgtgcgcggggaggaacgactgcatt
atcgacaagatccggaggaagaactgcccggcgtgccgctaccgcaagtgtctgcaggcc
ggcatgaacctcgaagctcgaaaaaccaagaagaagatcaaggggctgcagcaggcgggc
gcgcgggacnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnccgcagctgacgcccacgctggtgtcgctgctggaggtgatcgag
cccgaggtgctgtactcgggctacgacagcaccctgcccgactccagctggaggatcctc
tccaccctcaacatgctgggggggcggcaggtcgtggccgccgtcaagtgggcaaaggcc
attccaggtttccgaaatttgcatctggatgaccaaatgaccctcctgcagtactcatgg
atgttcctgatggcctttgctttgggctggcgatcatacaagcagtccaatggaaacctc
ctgtgctttgcaccagacctgatcattaacgagcagagaatgaatctaccctgtatgtat
gaacaatgcaaacacatgctaatggttgcccgagagctctcgcggcttcaagtctcctat
gaagagtatctctgcatgaaaacgttgcttctcctctctacaattcctaaggaaggcctg
aagagccagtctttgtttgaagagatccgtatgacctacattaaagagctgggaaaggcc
atagtgaaaagagaagggaactcgagccagaactggcagcgattttatcagctgactaaa
ctgttggactctatgcatgatgtggttgaaaatcttctgagcttttgcttccagacattt
ttggataaatccatgagtatcgagttcccggagatgttggcagaaatcatcagcaatcag
ataccaaaatattcaaatggaaatatcaagaagctcctatttcatcagaagtga

DBGET integrated database retrieval system