KEGG   Columba livia (rock pigeon): 102095228
Entry
102095228         CDS       T02912                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv05164  Influenza A
clv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102095228 (APAF1)
   04115 p53 signaling pathway
    102095228 (APAF1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102095228 (APAF1)
   05168 Herpes simplex virus 1 infection
    102095228 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD eIF2A CARD_2 Ge1_WD40 WD40_like Nup160 AAA_16 DUF2415 AAA_22
Other DBs
NCBI-GeneID: 102095228
NCBI-ProteinID: XP_005511762
UniProt: A0A2I0LUL5
LinkDB
Position
Unknown
AA seq 1248 aa
MDVKSRNYLLKNRQALEKDIKTSYIMDCMISDEVLTLEEEERVKQQNTQKEQAAMLINII
LTKDNNSYRSFYNALLHEGYRDLAELLQDGIPAISSDNGKTSMDGMTSDVRMILCEGGVP
QRPVVFVTRPKLVDAIKQKLYCLGNDPGWVTVYGMAGCGKTVLTAEALRDHQLLKDYFPG
GVHWISVGKQDKAGLLIKLQNLCSRLEHDSALSQRPPLNIEEAKDRLRLLMLRKYARSLL
ILDDIWDSWVLKAFDNQCQVLITSRDRSVTDAVSGKKYEVHVESGLAHEKGLEILSLFVN
MKISELPEQANCLVRECKGSPLVISLIGALLRDFPSRWDYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEQLNDNYKDYYKDLSILPKDVRVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDHNGKSFHYYLHDLQLDFLTEKNRNQLQELHKNIVNQYKKYYKLDTPVPSQEDC
MYWYNFLAYHMAGANMQKELCDLMFSLDWIKAKTELVGPAHLIHEYVEYSSVLDQKDSTV
RENFQEFLSLNGHLLGRKPFPDIIQLGLCQPETSEVYQQAKLRAQRQTGAFYLEWINKKS
LKNLYRLVVRPHRDAVYHACFSKDRQRIASCGADKTLQVFKAGSGERLLEINAHDDEILC
CAFSADGEFVATCSADKKVKIWNSRTGQCRCVYEEHTEQVNCCQFNNRSGQYVLATCSND
TFIKLWDLNKKYCRNTMMGHVNSVNHCRFSPNDEYVASCSTDGTVKLWETRSANELKSIE
IKDFFKNADEQPDDVEILVKCCSWSGNGDMILVVAKNKLLLFDVKTCVLLTQVIESHHST
IQYCDFCPGDELVAVALSHCSVELWNIKSLSKVAYCRGHMSWVHCVTFSPDGSLFLTSSD
DQTVRIWETKKVCKSSDAVLKSELDVVFYNGEVMILAIYNQKHLQLINGNTDSVIMQTAA
QESPISCCCLSEDLQFAAFGQESGTIKVLQLLDGKVLKSREAYRTSVQHCRFTSDCQTLI
SSAHDSIIQVWNWQSSECVFLRGHKEAVKDFRLLENSELLSWSFDGTVKVWNLTTGNTEK
DFACHGDAVLSCAVSPDGSKFSSTSADKTAKIWSFESSSVLHKLKGHEACVRCCTFSPNN
KLLATGDDKGEIRIWDILTGALLHFCSPVTADEEPTHGGWVTDLSFSPDSKMLVSSGGFL
KWWNVTTGESLQTFYTNGTNLKSIHVSPNFRMYVTVDNLGILYVLQKL
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggatgtcaaaagtagaaattatttacttaagaatcgccaagccttggaaaaagacatc
aagacctcttatattatggattgtatgatttctgatgaagtactaacattagaggaggag
gagagagtgaagcaacagaatacacagaaggagcaagcagctatgctaataaacattatt
cttacaaaagataataattcatatagatccttttataatgcactgcttcatgaagggtac
agagatcttgctgagcttcttcaggacggcatccctgccatctcctctgataatgggaag
acttcaatggatggaatgacttcagatgttaggatgattctctgcgaaggaggtgtgcca
cagagaccagttgtgtttgtcactcggccaaaactggtagatgctattaaacagaagttg
tactgcttgggaaatgatccaggttgggtcacagtttatggaatggcaggttgtgggaag
actgttttaacagcagaagctttacgggatcatcagctcttgaaagattactttccagga
ggagttcactggatctctgttggaaaacaggataaagcagggctcctaattaaacttcag
aatctctgcagtagattagaacatgactctgctctttcacaaaggccaccacttaacatt
gaggaggcgaaagatcgtcttcgattgctcatgctacgcaaatatgccagatctcttttg
atcttggatgacatttgggattcctgggtattaaaagcatttgataatcaatgtcaggtt
ctcatcaccagcagggacaggagcgtaacagatgctgtgtctggcaagaaatatgaggtt
catgtggaaagtggattagcacatgagaaaggattggagattttatcgctatttgtgaat
atgaaaatatcagaactgccagaacaagctaactgccttgtaagagaatgcaaaggttct
cctcttgtgatatccttgataggagcattattacgagacttccctagtcgctgggactac
tatctcaaacagctgcagaataagcagttcaaaagaataagaaaatcttcttcttatgat
tatgaagctcttgatgaagcaatgtccataagtgttgagcaactgaatgacaattataaa
gactactataaagacctctctatcctcccaaaagatgttagagtacctactaaggtgctc
tgtattctttgggatatggaaactgaagaagttgaagatatactacaggaatttgttaac
aaatcactattgttctgtgatcataatgggaagtcattccattattatttgcatgatctt
caacttgactttcttacagagaagaatcgcaaccagcttcaggagctacataaaaacata
gtaaatcagtacaagaaatattacaaacttgatacacctgttccttctcaagaggactgc
atgtactggtataactttctagcgtatcacatggctggtgccaacatgcagaaggaactc
tgtgatcttatgttttctctagattggattaaagctaaaacagaattggtagggcctgct
catctgattcatgaatacgtagaatatagttcagtcctggatcaaaaggatagcacagta
cgtgagaacttccaggaatttctgtctttaaatgggcaccttcttggacggaaaccattt
cctgacattatacagctgggtctttgccaaccagagacatcagaggtatatcaacaagcc
aagttacgtgctcaaagacaaacaggagcattttatttggaatggataaataaaaaatcc
ttgaaaaacctctaccgtctggttgttcgtccacatagagatgcagtttaccatgcctgc
ttttctaaggatagacaaagaatagcatcttgtggggctgataaaacacttcaggtgttt
aaagcaggaagtggagagagactcctggagataaatgcccacgatgatgaaatactttgt
tgcgctttctctgcagatggtgaatttgtagcaacttgttcagctgataaaaaagtaaag
atctggaattccagaacaggacagtgtaggtgtgtatatgaagaacacacagagcaagtc
aattgctgccagttcaataacagaagtggtcagtatgttttagccacctgctcaaatgac
actttcatcaaactttgggatttgaacaagaagtattgtagaaacacgatgatgggtcat
gtaaattccgtcaatcactgtagattttcaccaaatgatgaatatgttgctagctgttca
acagatggaacagtaaagctttgggaaacacggtcagcaaatgaactgaaaagtattgag
ataaaagatttcttcaaaaatgcagatgagcaaccagatgatgtggagattttagtaaaa
tgttgctcttggtctggaaatggtgacatgattttggtggtagccaaaaataagcttttg
ctctttgatgttaaaacgtgtgttttgttaacgcaagtcatcgaaagtcatcacagtaca
atccaatactgtgacttttgtcctggtgatgagttagtagcagttgctttgtctcactgt
tctgttgagttatggaatattaaatctttatcaaaagtagcatactgcaggggacacatg
agctgggttcactgtgtgacattttcgccagatggatctttatttctgacatcatctgat
gaccagacagtacgcatttgggaaacaaagaaggtgtgcaagtcttctgatgctgttcta
aaaagtgaactagatgttgtattttacaatggtgaagtgatgattttagcaatttacaat
cagaagcatttacaacttatcaatggaaatacagacagtgttattatgcagacagcagct
caagaatccccgatttcctgctgttgcttaagtgaagatcttcaatttgcagcttttgga
caggagagtggaacaataaaggtattacagttgttggatgggaaagttctgaagtcccgg
gaggcctacaggacatccgtgcagcattgtcgatttacatctgattgtcaaactcttatt
tcaagtgctcatgattccattatacaggtgtggaattggcagtcgagcgaatgtgtgttt
ctaagagggcacaaggaagcagtcaaagattttagacttctggaaaattcagaacttctt
tcttggtcgtttgatggaactgttaaggtttggaatctcactactggaaacacagaaaaa
gattttgcttgccatggcgatgctgttctttcctgtgctgtttcacctgatggcagtaaa
ttttcatctacttctgctgacaaaactgcaaagatatggagctttgaaagttcatctgtt
cttcataagctgaaaggtcatgaagcctgtgtgcggtgctgcactttctctcctaacaac
aaattattggccactggagatgacaaaggagaaataaggatttgggatattttaacaggt
gcattgcttcacttctgctccccagttactgcagatgaagaaccaacacatggtggctgg
gtaacagacctctcattttctcctgacagtaaaatgcttgtgtcatctggaggctttctg
aagtggtggaatgtaactactggagaatccttacaaaccttctacacaaatggaacaaac
ctcaagtcaatacatgtgtctcctaatttcagaatgtatgtgactgttgataatcttggt
attctttatgtattacagaagttgtga

DBGET integrated database retrieval system