KEGG   Columba livia (rock pigeon): 102095910
Entry
102095910         CDS       T02912                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
clv  Columba livia (rock pigeon)
SSDB
Motif
Pfam: RA Ras_bdg_2
Other DBs
NCBI-GeneID: 102095910
NCBI-ProteinID: XP_021156719
LinkDB
Position
Unknown
AA seq 255 aa
NTTSLIWGAKGWVALLTPILFPSPDCSFTCHYRFRALVRLDCSGPPGSGDENDGTEQALE
KDTNVDEPSEWEKTELDQAQVEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPV
SVPATKRVPSLQAGRSGPRTQGVKRRTSFYLPKGTIKHLHIFSHTRASEVIDALLRKFTV
IDNPRKFALFERSEKDEQVYLRKLADEEQPLRLRLLAGPSEKVLSFVLKENETGEVNVST
GMGRGQAPTPPRGRG
NT seq 768 nt   +upstreamnt  +downstreamnt
aataccaccagcctgatttggggtgccaagggatgggtggccctgctgacccccatcctg
ttcccgtccccagactgtagcttcacctgccactatcggttccgggccctggtgcggctg
gactgcagcggccccccgggcagcggcgacgagaacgatggcacggagcaggcactggag
aaggacaccaacgtggatgagcccagcgaatgggagaagacagagctggaccaggcgcag
gtggagcagcggatcaaggagtacaacagccagatcaacagcaacctcttcatgagcctg
aacaaggacggctcctacaccggcttcatcaaggtgcagctgaagctggtgcgccccgtc
tcagtgccggccaccaagcgggtcccctccctgcaggcggggcggtcggggccgcgcacc
cagggggtgaagcgccgcacgtccttctacctgcccaaggggaccatcaagcacctgcac
atcttctcacacacccgcgccagcgaggtcatcgacgccctcctccgcaagttcaccgtc
atcgacaacccccgcaagttcgccctctttgagaggtccgagaaggatgagcaagtgtac
ctgcggaagctggccgatgaggagcagcctttgcgactgcggctgctggccggtcccagt
gagaaggtgctgagcttcgtcctgaaggagaacgagactggggaggtgaatgtaagtaca
gggatggggagggggcaggcacccacaccccccaggggacgtggctga

DBGET integrated database retrieval system