KEGG   Columba livia (rock pigeon): 102096277Help
Entry
102096277         CDS       T02912                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00052  Galactose metabolism
clv00500  Starch and sucrose metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102096277
   00500 Starch and sucrose metabolism
    102096277
Enzymes [BR:clv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102096277
    3.2.1.20  alpha-glucosidase
     102096277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil DUF5110 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102096277
NCBI-ProteinID: XP_021135824
LinkDB All DBs
Position
Unknown
AA seq 1753 aa AA seqDB search
MGKRKFSGLEVTLIALFCLVVCVACVLIGLLASGQPGVKTPEFSADCPNILIQERIDCIP
DQIATKSTCNLRGCCWSPQSDTSVPWCFFASNHGYRVDGSTRSTQAGFEATLKRLPSPSL
FGNDIDTVLLTGEYQTANRFRFKITDPKTQRFEVPHEHVQPFTGSAASNLNYRVEVKQNP
FGIVVTRVSNGRVLFDTTIGPLQYADQFLQLSIKLPSINIYGVGEHVHKQYRHDXFLYWP
LCSKDWFLLFEMHNLYGVQTFFLCLEDSTGASFGVFLMNSNAMEFVVQPAPAVTYRTIGG
ILDFYIFLGNTPEQVVQEYIKFVGLPALPSYWSLGFQLSRWNYGSLDEVKRVVERNRATG
LPYDAQVTDIDYMEERKDFTYDKVNFQDLPQFADYMHEYGQKYIIILDPAISTQNLADGS
PYGSYVRGESKKVWVNESDGVTALIGEVWPGETVFPDFTNPDCTSWWVEEFRLFYNQVPY
DGIWIDMNEVSNFVQGSKDGCATNDLNYPPFTPSILDRLMFSKTLCMDAVQKWGKHYDVH
SLYGYSMAISTKKVIEEVFPGKRSYLISRSTFVGSGKHTGHWLGDNAATWDHIKWAIPGM
LDFNLFGIPYIGADICGFFDDTTEELCRRWMQVGAFYPFSRNHNAEGYIPQDPAVFGADS
ALVRTSKYYLNIRYTLLPYLYTLFYKAHTQGDTVVRPVLHEFYTDELTWNVDRQFLWGPG
LLISPVLDPGVDEIQAYVPDAVWYEYETGAKLNVRKQWTNLYLPADKLGLHLRGGYIYPT
QEPGNTTVASRRNPMGLIIALDDNNAASGDLFWDDGESTGTVESNNYIYYQFTVSNNVLQ
INAINSNYADPNNLKFEEIKILGALQEITSVTVSQNNVEESSTHNITYNPIEKVAHITGL
QLELGKSYTLRWTQEPNVNGRFDCYPSPDPTQAKCEQLGCIWEPVTSNLDIPPCYYSSDN
AYSIENVEYTSSGLTANLTLNSANTRANEEFITPISTLRLEVKYHLNNMLQFKIYDYQNA
RYEVPVPLNLPTTPTSTDAERLYEVSVQKRPFGIQVRRKSTGTVIWNSQLPTFTFSDMFI
QISTRLASQYIYGFGETEHTMFRRNMSWNTWGMFTRDQAPTYKLNSYGYQPFYMALEEDG
NAHGVLLLNSNAMDVTFQPTPALTYRTIGGILDFYMVLGPTPELVVQEYTALIGRPVMPP
YWSLGFQLCRYGYRNDSEISQLVDEMQAAEIPYDVQYADIDYMERQLDFTIGTRFDGLPA
LVNRIKAEGMRFIIILDPTISGNETNYPPFSRGVQDDVFIKWPNTNDIIYSKVWPFLPGV
DVNESLPEQTQIQIYGAHAAFPDFFRNSTAEWWKREIVEFYNHPTNPSRSVKFDGLWIDM
NEPAAFMNGAIGGCRNELLNMPPYIPYLGLRSEGLIVKTPCMEGQQYLPDGTPVRHYDVH
SLYGWSQTKPTLDGLQSVTNERGIVITRSTYPSSGKWAGHWLGDNTAAWDQLAKSIIGMM
EFSLFGISYTGADICGFFRDSQYELCVRWMQLGAFYPYSRNHNQKGTRRQDPVSWNSTFV
EISRHVLNVRYTLLPYLYTLMYDAHAHGSTVIRPVLHGFVEDRTTWEIYEQFLWGPALLI
SPVMQEDARTVNAYFPNARWYDYHTDENIGVRGEFRVLTAPLEHINLHIRGGHILAWQRP
ANTTFYSRKNAMGLTVALNDALFAEGQLYWDDGVRIDAYEDGVYLLTSFTADQLLTITSL
QLQLGQDYTLQWS
NT seq 5262 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaggaaattcagtgggctggaagtcaccctgatcgccctcttctgcttggtg
gtctgtgtagcctgtgtcctcattgggcttttagcatcaggacaacccggagtcaaaact
ccagaattttcagcggattgtccaaacatcttaatacaggagagaattgactgcatcccg
gatcaaatagcaacaaagagcacctgcaacctgcgtggctgctgctggagtccccagagc
gacaccagtgtgccctggtgttttttcgcttcaaaccacggctacagagtggatgggtcg
acacgatcaactcaggcagggttcgaggctacattaaaaaggctgccatcaccttctctc
tttggaaatgatattgacactgttctcctcacgggagagtatcagacagcaaatcgcttc
aggttcaagatcactgatcctaaaacgcaaagatttgaagtccctcatgagcatgtgcag
cctttcactggatccgcagcctccaatttaaactacagagtggaagtgaagcagaacccc
tttggcatcgtggtgaccagagtgagcaatggcagagtgctgtttgataccaccatagga
ccactgcagtatgctgaccagttcttacagctgtcaatcaaactacccagcatcaacatt
tatggtgtgggagagcacgtgcataagcagtaccggcatgacnngtttttatattggccc
ctctgcagtaaggactggtttttgttatttgaaatgcataacttatatggagttcaaact
ttcttcctgtgtttggaagacagcactggagcctcctttggtgttttcctaatgaacagc
aatgccatggagttcgtggtgcagcctgctcccgcagtgacctatagaaccattggtgga
atccttgatttctacatcttcttggggaacactccagagcaagtagtccaggagtacatc
aagtttgtgggattgccggcattgccttcctactggagcctgggcttccagctcagccgc
tggaattatgggtctctggatgaggtgaagagagtcgtggagaggaacagggcaactggg
ctcccgtatgatgctcaggtcacggacatagactatatggaggaaaggaaagattttact
tatgacaaagtgaattttcaagatctccctcaatttgcagattatatgcacgaatatgga
caaaaatatatcatcatattggatcctgctattagcacacagaatctagctgatggtagt
ccatatggaagctacgtcaggggagagagcaaaaaagtctgggttaatgaatcagatgga
gtaacagcattaattggggaggtgtggccaggggaaactgtgttcccagacttcaccaac
ccggactgcaccagctggtgggtggaagaattcagactgttttataaccaagtgccgtat
gatgggatctggattgatatgaatgaagtatccaactttgttcaaggctcaaaagatggt
tgtgcaacgaatgatttaaactatcctcctttcactcccagtattcttgacaggcttatg
ttttccaagacactttgcatggatgcagtgcagaagtgggggaaacattatgatgtccac
agtctctatggatattccatggccatatcaacaaagaaagtcatcgaagaagtgttccct
ggaaaacgaagctaccttatttcgaggtctacttttgttggatcaggaaagcacacagga
cactggctgggagataatgcagcaacatgggatcacataaaatgggcaatacctggaatg
ctggacttcaacctctttggaattccatatatcggagcagatatttgtggtttcttcgac
gacaccacagaagaactttgcagacggtggatgcaagtaggagcattttacccattttcc
aggaatcacaatgctgaaggatacatacctcaggatccagctgtctttggagctgattca
gccttggtgagaacctccaagtattacttgaacattcgctacaccttgctgccctacctg
tatacactcttttataaagctcacactcaaggagacaccgttgtacggccagttttgcat
gagttctacacagatgaactgacatggaatgtcgacaggcagttcctgtggggtcctggg
ctgcttatttcccctgtacttgacccgggtgtggatgaaattcaggcatatgttcctgat
gcagtatggtatgagtatgaaacgggggcaaaactcaatgtgagaaaacaatggactaac
ttgtacctgccagcagacaaactgggactccatttgagaggaggttacatttatcctact
caagaaccaggaaacacgacagttgcaagccgcaggaatccaatgggccttataattgct
ctggatgacaacaatgcagcttctggggacttgttctgggatgatggagaatctacaggc
acagtggagagtaacaactacatttactatcagtttacagtttccaataatgttctacaa
ataaatgctataaacagcaattatgctgatccaaacaacttgaaatttgaagaaatcaag
atattgggagcactccaggaaataacgtcagttactgtatctcagaacaatgttgaagaa
agttctacacataacatcacctataatcctatagaaaaggttgctcatataacaggactt
cagcttgaactgggaaaatcttacacattaagatggactcaagaaccaaatgtcaatgga
agatttgattgctatcccagtcccgacccaacacaagcaaaatgtgaacaactcggctgt
atttgggaaccagtaacatcaaacttggatattccaccctgctattacagctctgacaat
gcctattctatagaaaatgtagagtacacctcgtcaggtctgacagccaacctcacctta
aacagtgccaacaccagagctaatgaggaattcattacaccaattagcacactacgcttg
gaggtgaaatatcatctcaacaacatgctgcaatttaagatttatgactatcaaaatgca
cgatatgaggttccagtaccactaaacctcccgacgaccccaacgagtacggatgcggaa
cggctctatgaagtatcagttcagaaaaggccatttggtatccaggttcggcgcaaaagc
acaggaaccgtcatctggaattcacagctgcccacgttcacgttcagtgacatgttcatt
cagatttctacccgcttagcatcccagtatatatacggatttggagaaactgagcacacc
atgtttcgccgtaacatgagctggaacacctggggaatgttcacaagggatcaagctcct
acttacaagttgaattcctatggttatcagccattttacatggctcttgaagaagatggc
aatgcccatggagttctcctgcttaacagcaatgcaatggatgtgacgttccagccaacc
cctgccctgacgtaccgcaccattggaggaattctcgacttctacatggttttgggccca
acaccagaacttgttgttcaggagtacactgcactgattggccgaccggtcatgccaccc
tactggtctttgggattccagttgtgccgctacggatacagaaatgactcagaaatctcc
cagctggtggatgaaatgcaggcagctgagattccctatgatgttcaatatgcagatatt
gactatatggaaagacaactggacttcaccattggcacacgctttgatggattaccagct
ctggttaacagaataaaagcagaaggaatgagatttatcatcatcctggatccaaccatc
tctggaaatgaaaccaactatcctcctttctcaagaggtgtgcaggacgatgtcttcata
aaatggcccaataccaatgacattatatattccaaggtctggccgtttcttcccggtgta
gatgtcaatgagtcactgcctgagcaaacccaaatacagatctacggagcacacgcagct
ttcccagatttcttccgcaattccacagcggagtggtggaagagagaaatcgtggagttc
tacaaccatcccaccaacccctcgagaagcgtcaagtttgatggcctgtggattgacatg
aatgaaccagcagcttttatgaatggcgccattggcggctgtagaaatgaactgctaaat
atgcctccatatataccttatctgggacttcggtcagagggattaattgtgaaaactccg
tgcatggaaggtcaacaatatcttccggatggtaccccagtcagacattacgatgtccac
agtctttatggatggtcacaaacaaagcctaccctagatggtttgcagagtgtcaccaac
gagcgtgggattgttatcacccgttccacgtaccccagtagtggaaaatgggcaggacac
tggctcggcgataacactgcggcttgggatcagctggctaaatctattattggtatgatg
gagttcagtctctttggaatatcttacacaggagctgatatctgtggcttcttcagagac
tcgcagtacgagctgtgtgttcgctggatgcagctgggtgcattttatccgtattcaagg
aatcacaatcagaaaggaacaaggaggcaagatcctgtttcctggaactcaacgtttgtg
gagatttccaggcacgtgctaaatgtaagatacaccctgttaccctacttgtatacattg
atgtatgatgcccatgcccatggcagcaccgtgattcgccccgtactccatgggtttgtg
gaagacagaacaacctgggaaatatatgagcagttcctctggggacctgcgctgctcatc
agccctgtgatgcaagaggatgctcgaacggtgaacgcatacttccccaatgcccgctgg
tatgattaccacacagatgagaatattggtgttagaggagaattcagagttttaacagct
cctttggaacacatcaacctgcatatccgaggtgggcacatcctcgcttggcagagacct
gctaatacaactttttacagccgaaaaaacgcgatgggactcactgttgctttgaatgac
gctctgtttgcagaaggacagctttattgggatgatggggttcgcattgatgcatatgaa
gatggtgtatatctgcttacatcatttactgctgatcagctcctgacaatcaccagcctt
caacttcaattaggccaagactacacattgcaatggagctaa

DBGET integrated database retrieval system