KEGG   Columba livia (rock pigeon): 102096407Help
Entry
102096407         CDS       T02912                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00250  Alanine, aspartate and glutamate metabolism
clv00410  beta-Alanine metabolism
clv00430  Taurine and hypotaurine metabolism
clv00650  Butanoate metabolism
clv01100  Metabolic pathways
Module
clv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102096407 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102096407 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102096407 (GAD1)
   00430 Taurine and hypotaurine metabolism
    102096407 (GAD1)
Enzymes [BR:clv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102096407 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 SepSecS OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102096407
NCBI-ProteinID: NP_001302440
UniProt: A0A024BTI3
LinkDB All DBs
AA seq 590 aa AA seqDB search
MAASAPSSSNDAPDPTPTNLRPTTYDSWCGVAHGCTRKIGLKICGFLQRTNSLEDKGRIV
SSLKERQSSKNLLACENSEKESRFRRTETDFSNLYARDLLPAKNGEEQTMQFLLEVVDIL
LNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFG
TDNVILIKCNERGKIIPADLEAKILEAKQKGYIPLFVNATAGTTVYGAFDPIQEIADICE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVREKGIL
QGCNQMCAGYLFQQDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCL
ELAEYLYTKIKNREEFEMVFEGEPEHTNVCFWYIPPSLRGMPDCDERREKLHRVAPKIKA
LMMESGTTMVGYQPQGDKVNFFRMVISNPAATKSDIDFLIEEIERLGQEL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatctgctccctcgtcctccaacgacgctccggaccccaccccaactaattta
cgacccacaacttacgactcgtggtgcggcgtggctcacgggtgcaccaggaagatcggg
ctgaagatatgcgggttcctgcaaaggaccaacagcttggaagacaagggccggatcgtc
agctccctgaaggaacgacagtcctccaagaacctgctggcatgcgagaacagcgagaag
gaatccaggttccggcgcacggagacagacttctccaatttgtatgccagagatttgcta
cccgccaagaatggcgaggagcagaccatgcagttcctgctggaggtcgtggacatcctt
ctcaactacgtgaggaaaacgtttgacagatctactaaagtgctggacttccaccaccca
caccagctcttggagggcatggagggctttaacctggagctctcagacaaccccgagtct
ctggagcagatcctggtggactgccgggacacgctgaaatacggagtgaggacaggtcac
cctcgctttttcaatcagctgtctacaggactggacatcattggcttggctggggagtgg
ctgacgtcaactgctaacacaaacatgtttacctatgaaattgcccctgtttttgtcctc
atggaacaaataacacttcgaaagatgagagagattattggatggtcaaataaagatggt
gatggaatattctcacctggaggagctatctccaacatgtacagcataatggctgcacgc
tacaagtatttccctgaagtcaaaaccaaaggcatggctgcagttcctaaactggttctc
tttacctcagaacatagtcactactcaataaagaaagctggtgctgcacttggatttgga
acagacaacgtgattttgataaaatgcaatgaaagaggcaaaataataccagctgatttg
gaggcaaaaattctggaagcaaaacaaaagggatacattcctctctttgtaaatgcaact
gcaggaacaacagtatatggagcctttgatccaatacaggagattgcagatatatgtgaa
aaatacaacctctggctccacgtagatgctgcctggggaggtggactcttaatgtcccga
aagcatcgtcataagttgaatggaatagaaagagccaactccgtcacctggaatccacac
aagatgatgggagtgttgttacagtgttctgctattcttgtccgggagaagggtatactt
caaggctgcaatcaaatgtgtgcaggctatctcttccaacaagacaaacagtatgatgta
tcctacgacaccggagataaggcaatacagtgtggtcgacatgtggacattttcaaattc
tggttgatgtggaaggcaaagggtacagtaggttttgaaaatcagatcaacaaatgcctg
gagctggcagaatatctctacactaaaataaaaaatagagaagaatttgagatggttttt
gaaggggagccagagcacacaaatgtctgtttttggtatattccgccaagtctcaggggt
atgccagactgtgatgagagaagagaaaagttacacagggtggcaccgaaaatcaaagca
ctgatgatggagtcaggtactaccatggttggatatcagcctcagggcgataaagtcaac
ttcttccgaatggtcatctcaaacccagcagcaactaagtctgacattgacttcctcatt
gaggagatagagaggttggggcaggagctgtag

DBGET integrated database retrieval system