KEGG   Columba livia (rock pigeon): 102096788
Entry
102096788         CDS       T02912                                 

Gene name
RAF1
Definition
(RefSeq) LOW QUALITY PROTEIN: RAF proto-oncogene serine/threonine-protein kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04012  ErbB signaling pathway
clv04068  FoxO signaling pathway
clv04140  Autophagy - animal
clv04150  mTOR signaling pathway
clv04210  Apoptosis
clv04218  Cellular senescence
clv04270  Vascular smooth muscle contraction
clv04370  VEGF signaling pathway
clv04371  Apelin signaling pathway
clv04510  Focal adhesion
clv04540  Gap junction
clv04625  C-type lectin receptor signaling pathway
clv04810  Regulation of actin cytoskeleton
clv04910  Insulin signaling pathway
clv04912  GnRH signaling pathway
clv04914  Progesterone-mediated oocyte maturation
clv04916  Melanogenesis
clv05132  Salmonella infection
clv05164  Influenza A
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102096788 (RAF1)
   04012 ErbB signaling pathway
    102096788 (RAF1)
   04370 VEGF signaling pathway
    102096788 (RAF1)
   04371 Apelin signaling pathway
    102096788 (RAF1)
   04068 FoxO signaling pathway
    102096788 (RAF1)
   04150 mTOR signaling pathway
    102096788 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102096788 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    102096788 (RAF1)
   04218 Cellular senescence
    102096788 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102096788 (RAF1)
   04540 Gap junction
    102096788 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102096788 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102096788 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102096788 (RAF1)
   04912 GnRH signaling pathway
    102096788 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    102096788 (RAF1)
   04916 Melanogenesis
    102096788 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102096788 (RAF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102096788 (RAF1)
  09172 Infectious disease: viral
   05164 Influenza A
    102096788 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102096788 (RAF1)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102096788 (RAF1)
Protein kinases [BR:clv01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102096788 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 102096788
NCBI-ProteinID: XP_021143713
LinkDB
Position
Unknown
AA seq 654 aa
MEHIQGAWKTISNGFGLKDSVFDGPNCISPTIVQQFGYQRRASDDGKISDTSKTSNTIRV
FLPNKQRTVVNVRNGMTLHDCLMKALKVRGLQPECCAVFRLLTEPKGKKVRLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSNISDSGVPALPPLTMRRMRESVSRIPVSSQHRYSTPHAFTF
NTSNPSSEGSLSQRQRSTSTPNVHMVSTTMPVDNRIIEDAIRSHSESASPSALSGSPNNM
SPTGWSQQKPSPSPPKTPVPAQRERAPASNTQEKNKIRPRGQRDSSYYWEIEASEVMLST
RIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMT
KDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNN
IFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDSNPFSFQSDVYS
YGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCLKKVR
EERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINSCTLTSTRLPVF
NT seq 1965 nt   +upstreamnt  +downstreamnt
atggagcacattcagggagcttggaagactatcagtaatggttttggactcaaggattct
gtctttgatggcccaaactgtatctcacctactatcgtccagcagtttggttaccaacgc
cgagcatctgatgatggcaaaatatcagatacttccaaaactagtaacactattcgtgtt
ttcttgcccaacaagcagcgcaccgtggtgaatgtgcggaatgggatgaccttacatgat
tgtcttatgaaggcacttaaagtaagaggtctgcagccagaatgctgtgcggtttttcga
cttcttacggaaccaaaaggaaaaaaagtgcgtttggattggaatacagatgctgcctcc
ttgattggagaggaactgcaagtggactttcttgatcatgttccgctcaccacacacaat
tttgctcggaagacgtttctaaagcttgctttctgtgacatctgtcagaagttcctgcta
aatgggtttcggtgtcagacatgcggttataaattccacgaacactgcagcaccaaagtt
ccaaccatgtgtgtcgactggagcaatatcaggcaactcttattgttcccaaattcaaat
atcagtgacagtggtgtccctgcactacctcccttgacaatgagacggatgcgggagtct
gtctcccggatacctgttagttcccagcacaggtattccacacctcatgccttcacattc
aacacatcaaacccttcctctgagggctccctttcccaaagacagcgatctacgtccaca
ccaaatgtccacatggtcagcactacgatgcctgtagacaaccggataatcgaggatgca
attcgaagccatagtgaatcagcttcaccctctgctctgtctggaagtcctaacaatatg
agccccactggctggtctcagcaaaaacccagtcccagcccgcccaaaaccccagtccca
gcccaaagagagagagcccctgcatccaatacacaagaaaaaaacaaaatcaggcctcgt
ggacagagagattccagttattactgggaaatcgaagcaagcgaagtcatgctctccacc
agaatagggtcgggttcctttggaacggtttacaaaggcaaatggcatggggatgtagca
gtgaagatactaaaggttgtcgatccaaccccagaacagttccaggctttcagaaatgaa
gtggctgtattaaggaagactcggcatgttaatattttgctcttcatgggctacatgact
aaagacaacctggccattgtcacgcagtggtgcgaaggaagcagtttgtataaacacctg
catgtccaggagaccaagttccagatgttccagctcattgacatcgctcggcagacagca
cagggcatggactatttacatgcgaagaacatcatccacagagacatgaaatccaataat
atatttcttcatgaaggcctcacagtgaaaataggagactttgggctggcgacggtgaag
tcgcggtggagcggatctcagcaggtggagcagccgaccggctcgatcctgtggatggca
ccggaagtgattcggatgcaggacagtaacccgtttagtttccagtcagatgtctactcc
tatggaatagtattatatgaacttatgacgggcgagctgccgtactcccacattaacaac
cgagatcagatcattttcatggtgggccgagggtatgcgtctccagacctcagcaaactc
tacaagaactgccccaaggccatgaagcggctcgtagcagattgtttgaagaaagtcagg
gaagaacgacctctgtttccacaaatactgtcgtccattgaactgttgcaacattcttta
cccaaaatcaaccggagtgcttcggagccctccctgcaccgcgctgcccacacagaggac
atcaactcctgcacattaacgtccacgagactgcccgtgttttag

DBGET integrated database retrieval system