KEGG   Columba livia (rock pigeon): 102096820
Entry
102096820         CDS       T02912                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04012  ErbB signaling pathway
clv04068  FoxO signaling pathway
clv04110  Cell cycle
clv04115  p53 signaling pathway
clv04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102096820 (CDKN1A)
   04068 FoxO signaling pathway
    102096820 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102096820 (CDKN1A)
   04115 p53 signaling pathway
    102096820 (CDKN1A)
   04218 Cellular senescence
    102096820 (CDKN1A)
SSDB
Motif
Pfam: CDI ORC6
Other DBs
NCBI-GeneID: 102096820
NCBI-ProteinID: XP_005510416
UniProt: A0A2I0LZQ5
LinkDB
Position
Unknown
AA seq 150 aa
MPLSQSRARQLPCSSKVCRNLFGPVDHDQLQNDLDDLLRQNLEEAQQRWNFDFETETPLE
GHFKWERVFLDDQPPQEVRSPVKITGSESRSSLVHKVSPKSRLGRIRPEESQQSLEIHRA
GSPKISKRGQSTIKDFYSSKRRIVPDKPKP
NT seq 453 nt   +upstreamnt  +downstreamnt
atgcccctgtctcagagcagggccaggcagctgccatgcagcagcaaggtgtgcaggaac
ctctttggccccgtggaccacgaccagctccagaatgaccttgacgacctgttgaggcaa
aacctggaagaagctcagcagcgctggaacttcgactttgagacggagactcccttggaa
ggacacttcaagtgggagagggtcttcctggatgaccagccaccccaggaggtccgcagc
ccggtcaagatcaccggcagtgagagcaggagctccttggtccacaaggtctcccccaag
agccgtcttggcaggattcgccctgaggagtctcagcagagcttggagattcatagggct
ggttccccaaagatctcgaagcgtgggcagagcaccatcaaagacttctacagctccaag
cggaggattgtccccgacaagcccaagccgtga

DBGET integrated database retrieval system