KEGG   Columba livia (rock pigeon): 102097060
Entry
102097060         CDS       T02912                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102097060 (TGFA)
   04012 ErbB signaling pathway
    102097060 (TGFA)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 102097060
NCBI-ProteinID: XP_021136628
LinkDB
Position
Unknown
AA seq 231 aa
MAAPHPRASFPVSRRFRAAPCTLVHPISGQIPAVPAGLSHARLHPRRSRNLRLRFRRCQH
ILTPGGKRRLFVRLARDFPTGFLGVLLAVCHALENTTAARSAPGPPVAAAVRSHFNDCPD
SHSQFCFHGTCRFLVQEEKPACVCHSGYVGTRCEHADLLAVVAANQKKQTITALVVVSVV
ASALLVGICLLIHCCRRWKRCPWCRTPGGGDQEKPGGLLKSGASCCHSETG
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcggcgccgcatcctcgtgcatcgttcccggtgtcacggcggttccgtgcagccccg
tgcacactcgttcaccccatctcgggacaaattcctgccgttcctgccgggctgagtcac
gcgcggctccatccccggagatcccgcaacctccgtctccgcttccgaaggtgccaacac
atcctcacgccgggaggaaagagacgcctgttcgtccgactcgcccgtgacttcccgacc
ggctttctaggtgtgctgctcgccgtgtgccacgcgctggagaacaccacggcggcccgg
agcgctccaggcccgccggtggcggcggcggtgaggtcccacttcaacgactgtcccgac
tcccacagccagttctgcttccacggcacctgccggttcctggtccaggaggagaagccg
gcgtgtgtgtgccactcggggtacgtggggacacggtgcgagcacgccgacctcctggcc
gtggtggccgccaaccagaagaagcagacaatcaccgccttggtggtggtgtccgtggtg
gcctcggcgctgctcgtcggcatctgcctccttatacactgctgccggcggtggaaacgt
tgcccatggtgccggacgcccggcgggggggaccaggagaaaccaggggggctcttaaaa
agcggcgcctcctgttgtcatagcgagacgggt

DBGET integrated database retrieval system