KEGG   Columba livia (rock pigeon): 102097498Help
Entry
102097498         CDS       T02912                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00010  Glycolysis / Gluconeogenesis
clv00053  Ascorbate and aldarate metabolism
clv00071  Fatty acid degradation
clv00280  Valine, leucine and isoleucine degradation
clv00310  Lysine degradation
clv00330  Arginine and proline metabolism
clv00340  Histidine metabolism
clv00380  Tryptophan metabolism
clv00410  beta-Alanine metabolism
clv00561  Glycerolipid metabolism
clv00620  Pyruvate metabolism
clv01100  Metabolic pathways
Module
clv_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102097498 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102097498 (ALDH2)
   00620 Pyruvate metabolism
    102097498 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102097498 (ALDH2)
   00561 Glycerolipid metabolism
    102097498 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102097498 (ALDH2)
   00310 Lysine degradation
    102097498 (ALDH2)
   00330 Arginine and proline metabolism
    102097498 (ALDH2)
   00340 Histidine metabolism
    102097498 (ALDH2)
   00380 Tryptophan metabolism
    102097498 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102097498 (ALDH2)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102097498 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 102097498
NCBI-ProteinID: XP_021141146
LinkDB All DBs
Position
Unknown
AA seq 422 aa AA seqDB search
MDASHRGKLLNRLADLIERDRAYLAALETLDNGKPYAISYLVDLDMVVKCLRYFAGWSDK
FHGKTIPLDGDFFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTP
LSALYVANLVKEAGFPPGVVNIIPGYGPTAGAAISSHMDVDKVAFTGSTEVGHLIQKAAA
ESNLKRVTLELGGKSPNIIMSDADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYNEF
VERSVEKAKARVVGNPFDFKTEQGPQVDEEQFKKILGYISTGKQEGAKLLCGGSAAADRG
FFIQPTVFGDVQDNMTIAREEIFGPVMQILKFKTIEEVIERANDSKYGLAAAVFTKDLDK
ANYVSQSLRAGTVWINCYDVFGAQAPFGGYKASGNGRELGEYGLEAYVEVKNVTIKIPQK
NS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacgcttctcatcgggggaagctgctgaatcgtcttgcagacctgatcgagagggac
cgggcttacctggcggcgctggagactctggataacggcaaaccgtatgccatctcctac
ctggtggatctggacatggtggtcaagtgtctcagatactttgcaggctggtcagataaa
ttccacggcaaaaccatcccattagatggagacttcttctgttatacaaggcacgagccg
gtgggagtctgtgggcagataatcccgtggaacttcccactgttgatgcaagcatggaaa
ctggggcctgccttggcgactgggaacgtggttgtgatgaaagtggcggagcaaaccccc
ctgagcgctctttatgtggctaatttggtcaaagaggctgggttcccgcccggtgtggtg
aacatcatccctggctatgggcccacggccggcgctgccatctcctcccacatggatgtt
gataaagtggccttcactggctccacagaggttgggcacctgatccagaaggcagcagca
gagagtaacctcaagagggtgacgctggagcttggcgggaagagtcccaacatcattatg
tccgacgcagacatggactgggctgtggaccaagcccattttgccctcttcttcaaccaa
gggcagtgctgctgtgctggatcccgaacatatgtccaggaggatatatataatgagttt
gtggagaggagtgttgagaaggccaaggccagggtggttggaaacccgtttgactttaaa
actgaacaggggcctcaggtagacgaggagcagtttaagaagatcctgggttacattagc
actgggaagcaagaaggagccaaactgctgtgtggtggcagcgccgctgcggacagaggc
ttcttcatccagccaactgtctttggcgacgtgcaggacaacatgacgatcgccagggag
gagatatttgggccggtcatgcagattctgaaattcaaaacaatcgaggaagtcattgag
agagcaaacgactccaagtatggtctggcagccgcagtcttcacaaaggatcttgacaaa
gcgaactatgtgtcccagagcctgcgagctggaacagtttggataaactgctacgacgtg
tttggtgcgcaagccccatttggcggctacaaagcttctgggaatgggcgagagctggga
gaatatggtctggaggcgtatgtagaggtgaaaaatgtgacgatcaaaatcccacagaaa
aactcctaa

DBGET integrated database retrieval system