KEGG   Columba livia (rock pigeon): 102097535Help
Entry
102097535         CDS       T02912                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00040  Pentose and glucuronate interconversions
clv00051  Fructose and mannose metabolism
clv01100  Metabolic pathways
Module
clv_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102097535 (SORD)
   00051 Fructose and mannose metabolism
    102097535 (SORD)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     102097535 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 DUF2249 DUF281
Motif
Other DBs
NCBI-GeneID: 102097535
NCBI-ProteinID: XP_013224743
UniProt: A0A2I0LP07
LinkDB All DBs
Position
Unknown
AA seq 355 aa AA seqDB search
MVMKSSLVALINFGGDSILEENRPIPEPGPNEVLLQMHSVGICGSDVHYWQHGRIGDFVV
KNPMVLGHEASGTVIKVGSGVTHLKPGDRVAIEPGVPREMDEFCKTGRYNLSPTIFFCAT
PPDDGNLCRYYKHNASYCYKLPDNVTFEEGALIEPLSVGIHACKRAGVTLGSKVFVSGSG
PIGLVNVLVAKMMGAAAVVVTDLSASRLQKAKEVGADFTIQVTTETPQEVASKVEALLGC
MPEMTVECTGVQACIQTGIYATRSGGTLVLVGLGPEMVTLPVVNAAVREVDIRGIFRYCN
TWPVAIALLASKRINVKPLVTHRFPLEKALEAFETTRRGEGIKVMLKCDPTDHNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggttatgaagagttccttggtagcactaattaactttggtggggactcgatcctagag
gaaaaccgtccgatcccagaaccgggtcccaacgaggtgctgctgcagatgcactctgtt
gggatctgcggctccgacgttcactactggcagcacggccgcatcggggattttgtggtg
aagaaccccatggtgctggggcacgaagcttctgggaccgtcatcaaagtgggatcggga
gtgactcatctgaaaccaggtgaccgagtggccatcgagcccggcgtcccgagagaaatg
gacgagttctgcaaaaccggccgctacaacttgtctccaaccatcttcttctgcgcgacg
cctcccgacgacggcaacttgtgccgctactacaagcacaacgccagctactgctacaag
cttccagataacgtcacctttgaagaaggagcccttatcgagccgctttcggtgggaatc
catgcctgcaaaagggcgggagtcactctgggaagcaaagtcttcgtgtctggctccgga
ccaattggcctcgttaacgtgcttgttgctaagatgatgggcgcagcagctgtggtagtt
acagatttatccgcctctcgcctgcaaaaagccaaggaggtgggggcggatttcaccatc
caggtgacgaccgagaccccgcaggaggtggcctccaaggtggaggctctgctgggctgc
atgcccgagatgacggtggagtgcaccggggtgcaggcctgcatccagactggcatctac
gccacccgttctggtgggaccttggtgctggtggggctggggcctgagatggtgacgttg
cccgtggtgaacgcggccgtgcgggaagtcgacatccgggggatcttccgctactgcaac
acgtggccagtggccattgctctgctggcatccaagcggatcaacgtgaagcccttggtc
acccaccgcttccccctggaaaaggccctggaggcctttgagaccaccaggaggggtgag
gggatcaaagtcatgctgaagtgtgaccccactgaccacaacccttga

DBGET integrated database retrieval system