KEGG   Columba livia (rock pigeon): 102097536
Entry
102097536         CDS       T02912                                 

Definition
(RefSeq) p53 apoptosis effector related to PMP-22
  KO
K10136  TP53 apoptosis effector
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102097536
SSDB
Motif
Pfam: PMP22_Claudin L_HMGIC_fpl PalH PTR2 DUF3488 Pox_A14
Other DBs
NCBI-GeneID: 102097536
NCBI-ProteinID: XP_005509473
UniProt: A0A2I0MUN1
LinkDB
Position
Unknown
AA seq 189 aa
MVKYGLDYTRCRWILPLLLGIGVIFGIIALSGRGWLESQTLPYIHQASLWQSCRRPEQGG
EWSCESLMGYAWGRAAAATYLVGFILLVICFALAIIAFAIDTLRFNFIRGIGGLLFVAAM
FSIMGLVIYPVKFSTEIEMTGINMFSWAYGFGWTTAIMEICLGFFFCCLPNYEDQILGNV
KPTYFYSAP
NT seq 570 nt   +upstreamnt  +downstreamnt
atggtgaagtacggccttgactacacgcggtgcagatggatcctacccctgctcctgggc
ataggcgtcatctttggtatcattgcgctgtcgggcaggggctggctggagtcgcagacc
ttgccctacatacatcaagcatcgttatggcagagctgcaggaggcctgagcagggtggg
gaatggagctgcgagtccctcatgggttacgcttggggaagagctgctgctgccacatac
ctggtcggttttatactcctagtcatctgttttgctctggccatcattgcatttgccatt
gacacacttcggttcaacttcatacgagggattggaggcttgctttttgtcgctgctatg
ttctccatcatgggcctggtcatttatccagtaaagttctcgactgaaattgaaatgaca
ggaatcaatatgttcagctgggcctacggctttggctggaccacagccatcatggaaata
tgtttgggattcttcttctgctgccttcctaactacgaagatcagatcttgggtaatgtg
aagcccacatatttttactctgccccgtaa

KEGG   Columba livia (rock pigeon): 102097711
Entry
102097711         CDS       T02912                                 

Definition
(RefSeq) p53 apoptosis effector related to PMP-22
  KO
K10136  TP53 apoptosis effector
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102097711
SSDB
Motif
Pfam: PMP22_Claudin L_HMGIC_fpl
Other DBs
NCBI-GeneID: 102097711
NCBI-ProteinID: XP_005509474
UniProt: A0A2I0MUK4
LinkDB
Position
Unknown
AA seq 196 aa
MVVCGLACWRCRWLLPLLLGLAIIMGIIALAGRGWLESESEPYVQQASLWESCTRGEEDL
NWNCESLMDYGWGRAAAATYLVGFVILVICFALAVIAFSIEILRFNFVRGIGGLLFVVAA
FQIIGLVIYPVKFTEEIPLTGDNMFSWAYGFGWASTVVVIGCAFFFCCLPNWEDEVLGNI
KPSCYYSSPERAPYLN
NT seq 591 nt   +upstreamnt  +downstreamnt
atggtggtgtgcggcctcgcttgctggaggtgcaggtggctcctgcccctgctgctgggc
ctggccatcatcatgggcatcatcgccttggcgggcaggggctggctggagtctgagtcg
gagccctatgtgcagcaagcttcgctatgggagagctgcacccggggtgaggaggacctc
aactggaactgcgagtccctcatggactacggatgggggagagcagcagctgccacatac
ctcgttggctttgtgatcctggtcatctgttttgccctcgcagtcattgcgttctcaatc
gagatactccgcttcaactttgtgcgaggaattggaggcttgctctttgtcgttgctgca
ttccagatcataggcttggttatctacccggtgaaattcacagaagaaattccactgaca
ggagataacatgttcagctgggcctatggctttggttgggccagcactgttgttgtaata
gggtgtgctttcttcttctgctgcctccccaactgggaagatgaagtcctgggaaacatc
aagcctagctgttattactcctccccagagagagcaccgtacttaaattga

DBGET integrated database retrieval system