KEGG   Columba livia (rock pigeon): 102097806
Entry
102097806         CDS       T02912                                 

Gene name
SFN
Definition
(RefSeq) 14-3-3 protein sigma
  KO
K06644  stratifin
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04110  Cell cycle
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102097806 (SFN)
   04115 p53 signaling pathway
    102097806 (SFN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clv04147]
    102097806 (SFN)
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102097806 (SFN)
  Exosomal proteins of colorectal cancer cells
   102097806 (SFN)
  Exosomal proteins of bladder cancer cells
   102097806 (SFN)
SSDB
Motif
Pfam: 14-3-3 TPR_12 Peptidase_C98 Anticodon_1 FliM
Other DBs
NCBI-GeneID: 102097806
NCBI-ProteinID: XP_005500718
UniProt: R7VSB6
LinkDB
Position
Unknown
AA seq 246 aa
MARNHQVQKAKLAEQAERYEDMADFMKAVVEHGDELSNEERNLLSVAYKNVVGCQRSAWR
VISSIEHKTEEGDDKAQLVNEYREKVEQELNSVCNNVLDLLDKYLIKKASDAESKVFYLK
MKGDYFRYLAEVASGDNRQKTIDNAQKAYQEAMDISKKEMQPTNPIRLGLALNFSVFHYE
IANAPEQAISLAKTTFDEAMGDLHTLSEDSYKDSTLIMQLLRDNLTLWTAECAGEDGGEA
GEEPKN
NT seq 741 nt   +upstreamnt  +downstreamnt
atggcaagaaaccaccaagtgcagaaggccaagctggccgagcaggctgagcgctacgag
gacatggcggacttcatgaaggcggtggtggagcacggggacgagctgtccaacgaggag
cggaacctcctctccgtcgcctacaagaacgtggtggggtgccagcgctcggcgtggagg
gtcatctccagcatcgagcacaaaaccgaagaaggggacgacaaagcgcagctggtgaac
gagtatcgggagaaggtggaacaggagctgaactcagtctgcaacaacgtcctggacttg
ctggacaagtatctcatcaagaaagcgagcgacgccgagagcaaagtcttctacttgaag
atgaagggcgattacttccgatacctggccgaggtggccagcggagacaaccgccagaag
acgatagacaacgcccagaaagcctaccaagaggccatggacatcagcaaaaaggagatg
cagcccacgaaccccatccgcctggggctggccctcaacttctccgtcttccactacgag
atcgccaacgcccccgagcaggccatctccttggccaagaccaccttcgacgaggccatg
ggcgacctgcacacgctcagcgaagactcctacaaggacagcaccctcatcatgcagctg
ctcagggacaacctcacgctatggacagccgagtgcgccggggaagacggcggcgaagct
ggcgaagagcccaagaactga

DBGET integrated database retrieval system