KEGG   Columba livia (rock pigeon): 102098192Help
Entry
102098192         CDS       T02912                                 

Gene name
SETD2
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102098192 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:clv03036]
    102098192 (SETD2)
Enzymes [BR:clv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102098192 (SETD2)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102098192 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 102098192
NCBI-ProteinID: XP_021156374
LinkDB All DBs
Position
Unknown
AA seq 2306 aa AA seqDB search
TEITPQKEDSHIGKEEEVSDGSKGAALCSRRPGSKRKFSQSDGTVLGSESDEDSVRTSSS
QRSHELKVSSTEKERDPRRSSASLRGDDPGKSSSRSKSDRDEKYSSYSKSERDSDRDEKY
SSYSKSERDSRYSFSRSRSDRERRRSRSHSRSRSDRSSRTSSSYSRSERSHYYESDRRYH
RSSPYRERSRYSRSYADSRARDSSDSDDEYRRTHSRSSDSRRTSSHSSSSYRDSRSSYSK
SDRDSKVESSHADAERRGRSSKADRDSKRTSESEVTKRCSPLDELGYRKGTSHSKPDSNV
NSSRYKSTPSKTPTPKPDKFKSSFCCTESIEEIKQQSNSLDSEASCLKSSEIRMSVVRRF
EREKTLSPLHQLNDSPACKKADESKAGFASSEELAGNECHNSVKEQETLLKIKHEQLRTC
YPLELSVNGSLEGRADALATSSASRPEDVAVSSGDSLCRSEASPVVEMNPSYPLPSNGLE
STCASREQEPDDSRVQSSECNSLFGEAEAPAPQQQEESTPLPVLNVDHSQTILKKLDDQA
TLCDKTKEPLLCYISDDTAPALYHSEVEIEAEPVDIKVTSEAFLDVQVEPQTVTCEYESA
EDQHVGSACDGEHDRPSPKTDPAAESSGRDSSQDGSSPRLRDHPVLGESTSSKWDVPPPH
LESDEALELGTRRVSPGSAQGKLSFRDEHSYYSEAPLEHRDREVVEESAVSTGGAGPDDL
SIQCPSVSAEKDEGHEPFVASAFPDALFPSCDVVVTAEETETVTQAPTCDSSGNTSEFIP
AGHHDYSDTGESDSEGGSEDSDTEDSDSDDGTPRKRLQSVVVVPKNSTIAMEESSPGSSR
SSQGNRRFSDHWDDERPEPSRPYYEERSENVANKGGSQVESXXXXXXXXXXXXXXXXXXX
XXXXXXDGVDSTSQADLTADSHGKANPDERMALKELVSIGRPVGRQDEQPFCLPESYESA
DKSRPQTSFSKPDSRQGKAGLNQSGLGDFSRLGGFHPPEDLGGLSWDFSQVETPSSTYQQ
PDSSFGVYSGYVYQPGSGAYGGSQTYWQGNGYWXFFLPSAVNYERIQGQVPDSLTEDHEE
YEEDERWDDECKPHFPSPSGKCQAPGPKEQGSVQAHEISSNSTKEPLPGGEKKEEAKASD
KNDAKERGPPKKRRPELESDSESDVDSREKKKANVEGQAAEPAPQDSSMVGRLCIMDDFR
DPQRWKEFAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMLCECPPLSKEERAQGEVA
CGEDCLNRLLMIECSSRCPNGDYCSNRRFQKKQHADVEVILTEKKGWGLRAAKDLPSNTF
VLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNC
ETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRV
SIRAAGGKMKKERSRKKDSVDGELEALLENGEGLSDKNQVLSLSRLMVRIETLEQKLTCL
KLIQNTHSQSCLKSFLECHGLSLLWIWMTELGDGRGSSANNLKLQLEIMKTLELLPIPTK
NMLEESKVLPVIQRWAQTKSAVPQLSEGDGYSSENTSRAHTPLNTPDLSAKQSAEGDTDT
PKKLVFRRLKIISENSMDSAISDTTSELEGKEGKEDLDQLEGAAMEVAEEQQPQQEIKTA
VDAAVESSKPQTAELEAEPEAEVKESNGAKLEEPIAMETPSQDEEEGVSDVESERSQEQT
DKIVDVSDLATRLLDSWKELKEVYRIPKKSQAEKENSADRGRETAGHKDQTPTPKNPVLS
RERDPERQSQSKEKKRRRDSLSPPSSAYERGTKRPEDRYDTPASSKKKVRLKDRNKLSTE
ERRKLFEQEVAQREAQKQQQQLQNLGMTSPLPYDSMGYGASHHSFIGYPPGYPMQAYVDP
SNPNAGKVLLPTPTMDSMCSPAPYEHPQTLVGHTVEPTLTTPQPVPVVQHVATPMEVTTP
QYVAQSDAVVHQEANVAVLPVATAGAVQSQSYGVWDSAQQPVAVPQQYSPAQSQTAIYYQ
GQTCQTVYGVTSPYSQTTPPIVQSYAQPSLQYIQSQQIYTAHPQGVIVQPPTAVTTIVAA
GQPQPIQQPELVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVVTRQTQWD
PPTWDSPGDDASLEHEAEMDLGTPTYDENPMKSSKKAKTAEADTSSELAKKSKEVFRKEM
SQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKH
KTKEYIKKYMQKFGAIYKPKEDTDLE
NT seq 6921 nt NT seq  +upstreamnt  +downstreamnt
acagaaataactccgcagaaggaagattcccatattgggaaggaggaggaggtttccgac
ggctcgaagggcgctgcgctctgctcccggcggcccggctccaagaggaagttctcgcag
tccgacggcacggtgctgggctccgagtccgacgaagattcggtgaggacctcgtccagc
cagcggtcccacgagctgaaggtatccagtacggaaaaggagagagatcccagaagaagc
tccgcgtccctcagaggtgacgacccagggaaatcctcctcgcgttccaagtcggacagg
gatgagaagtactcgagctattccaaatcagaaagagattcggacagggatgagaagtac
tcgagctattccaaatcggaaagagattcacggtattcgttctcccgctctcggtcggac
agagagaggaggcgaagccgatctcattcccggtcccgatccgaccggagctcccgaacc
agctcttcctactccaggtcggagcgctcgcattactacgaatccgaccgcagataccac
cggagctccccgtacagggaaaggtcgcgatactcccgttcgtacgcggacagccgggcg
cgagatagctcggactcggacgacgagtatcggaggacacattccagatcgagcgactcc
aggcggacgtcgtcccactcctcctcctcctacagagactccaggagttcttactctaag
tcggacagggacagcaaagtagagtcgtctcacgccgatgcggagaggagaggaagatct
tcgaaagcagatagagattccaaaaggacttccgaaagcgaagtaaccaaaaggtgctct
ccccttgacgagctaggctaccgaaaggggacatcccattctaagcccgacagtaatgtg
aattcctcccgttataagtccaccccttcaaagacccccacaccaaagcctgataaattt
aagagttctttctgttgtacagaatcgatcgaagaaataaaacagcagtctaattctcta
gattcagaggcctcttgtctaaaaagcagtgagatcaggatgtccgtcgtgagaagattt
gaaagggaaaagacgctttctccgctacatcagttgaacgattcgcccgcttgtaaaaag
gcagacgaatcgaaagcgggttttgccagctccgaggagcttgcaggaaacgaatgccac
aacagtgttaaggaacaagaaactttattaaagataaagcatgaacagttaagaacgtgt
taccctttggagctgagtgtaaatgggtccctggagggtagagctgatgctttggcaaca
tccagtgcctccagaccagaggatgtggccgtgtcttctggcgatagcctgtgtcgctca
gaagcatcacctgtcgtggagatgaacccgtcgtatccgttgccgtctaacgggttggag
agcacgtgcgcgtctcgagagcaggagcccgacgactctcgggtccagtccagcgagtgc
aacagcctgtttggggaagcggaggctccggccccgcagcagcaggaggaatccacccct
ttgcccgtcctgaatgtagatcactctcaaaccatacttaaaaagctggacgatcaggcg
actctgtgcgacaaaaccaaagaaccattgctttgctacatttcggacgataccgccccc
gctttgtaccattcggaagttgaaatcgaagcggaaccggtggatataaaagttacgtcc
gaggcttttctggacgtgcaggtggagccgcagacggttacgtgtgagtacgagagcgcg
gaagatcagcacgtggggtcggcctgtgatggggagcacgaccgtccctccccgaaaacg
gacccggccgcggagagctcgggcagggattcctcccaggatggctcttccccgaggctc
agggaccatcccgtgctgggggaaagcacctcttccaaatgggacgtgccgccgccacat
ttggaatccgacgaggcgctggagttggggacccggcgcgtcagccccggttcggcacaa
ggcaagttgtcgttccgagatgaacattcgtactattcggaagcgccgctggagcaccgc
gacagagaggttgtggaagaaagcgccgtatccaccgggggcgccgggccggatgatttg
agcattcagtgtcccagcgtatcagccgagaaggatgagggacacgagccttttgtggct
tcggcttttccagacgccttatttccctcttgcgatgttgttgtcaccgcagaagagaca
gaaacggtgactcaagccccgacgtgcgacagcagcggcaacacctccgaattcatccct
gccggccaccacgattactcggacacgggggagagcgacagcgaggggggcagcgaagac
agtgacacggaggactcggattctgatgacggcacgccacggaaacgcctgcagtccgtg
gtggtggtgccgaagaactcgactatcgccatggaggagagcagccctggttcctcgcgg
agcagccagggcaaccggcgcttctccgaccactgggacgacgagcgacccgagcccagt
agaccctactacgaagagagatcggagaacgtggcgaataaaggcggttcacaagtagag
agcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnngacggtgttgacagcacgagccaggcggacctgacggcggat
tcccacggcaaagccaacccggacgagaggatggctttgaaggagctcgtctccatcggc
agacccgtcggccgccaagatgagcagcccttttgtctaccggagagttacgaaagcgcc
gataaatcccgaccccagacgagcttttccaagccggacagtaggcaggggaaggctggg
cttaaccagtctggccttggggacttctccaggttgggtggtttccatccgccagaggat
ctgggtggtttgagctgggacttctcacaggtggagacgcccagtagcacctaccagcaa
ccagacagcagtttcggcgtctactcgggctacgtttaccagccgggctcgggcgcgtac
ggtggctctcagacgtactggcaaggcaatggctactggnngttttttttaccttccgcc
gttaattacgaacgaattcaagggcaagtcccggattcgctgacggaggatcacgaggaa
tatgaagaggatgagcgctgggacgacgagtgcaaacctcatttccccagcccctcgggt
aaatgccaagcgccggggccgaaggaacaaggttcggtgcaggcacacgagatcagcagc
aattccaccaaggagccgctgcctggcggcgagaagaaggaagaggcgaaagcttcagat
aaaaacgatgcgaaagagcgaggcccgccaaaaaaaagacgcccggagttggagagtgat
tccgagagcgacgtggactcgagggagaagaagaaggcgaatgtggaggggcaagcggcg
gagccggcgccgcaggactcctccatggtcgggcggttgtgcatcatggacgatttccga
gacccacagcgctggaaggagttcgccaagcaagggaagatgccctgttactttgacctc
attgaggagaacgtctacttgacagaaaggaagaagaacaaatctcaccgggacatcaag
cggatgctgtgcgagtgtccccccctctccaaagaagagcgagcgcagggggaggtggcc
tgtggagaagattgtctgaaccgcctgctcatgatcgagtgttcttcccggtgcccgaac
ggtgactactgctccaaccggcgcttccagaagaagcaacacgcggacgtcgaggtgatc
ctgaccgaaaagaaaggctgggggctgcgagccgccaaagatctgccatccaacactttt
gtcttggaatactgcggggaggtgctggatcacaaggagttcaaggctcgcgtgaaggaa
tacgcccgcaacaagaacattcactattatttcatggccctgaagaatgacgagataatc
gacgctacgcagaaaggaaactgctctcggtttatgaaccacagctgtgaacccaactgc
gagacacaaaagtggacggtgaacgggcagctccgagttgggtttttcaccaccaaactg
gtcccgtcgggctccgagctgacgttcgattaccagttccagagatacggcaaagaggct
caaaaatgtttctgcggctccgccaactgccgggggtacctgggaggggagaacagggtg
agcatccgcgcggccggcggcaagatgaagaaggagcgatcccgtaagaaggactcggtg
gacggggagctggaggcgctgctggagaacggagaagggctctccgataaaaaccaggtc
ctcagcttgtcccgcctcatggttcgcatcgaaacgctggagcagaaactcacctgcctc
aaactcatccagaacacgcactcgcagtcctgcctaaagtccttcctggagtgtcacggt
ttgtctctgctctggatttggatgacggagctgggcgatggcagagggagcagcgctaac
aacctcaagttgcagctggagatcatgaagacgctcgagctcctgcccatccccaccaag
aacatgctggaggagagcaaagtcctgcccgtgatccagcgctgggctcagaccaagagc
gcggtgccgcagctcagcgaaggggacggctactccagcgagaacacctcgcgggcccac
acgccgctcaacacgcccgacctctccgccaagcagagcgcggagggtgacacggacacc
cccaagaagctggtgtttcggaggttgaaaattataagcgagaacagcatggacagtgcc
atctcggatacaaccagcgagctggaagggaaggagggcaaagaggacctggaccagctg
gagggagccgcgatggaggtggcggaagagcagcagccgcagcaggagatcaaaaccgcg
gtggacgcggcggtggagagcagcaaaccccaaacggcggagctggaggccgagcccgaa
gccgaggtgaaagagagcaacggcgccaagttagaagagcccatcgcgatggagacgccg
tctcaagacgaagaggaaggcgtatctgacgtggagagcgagaggagccaggagcagacg
gacaagatcgtggacgtgagcgatctggcaaccaggctgctcgacagctggaaggagctc
aaggaggtttatcgcatccccaagaagagtcaagcggagaaggagaacagtgccgaccgt
gggagggaaaccgccggccacaaggatcagactcccactcccaagaaccccgtcctgagc
agagagcgggaccccgagcggcagagccagagtaaagagaagaagagacggcgagactcg
ttgtcccctccgtcctcggcgtacgagcgaggaaccaagcggccggaggacaggtatgac
acaccagcatcttcaaagaagaaagtccgcctcaaggaccgcaacaagctctccacagaa
gagcgcaggaagctctttgagcaagaagtcgcccaacgcgaagcccagaaacaacaacag
cagctccaaaacctggggatgacgtcccccttgccctacgactccatgggctatggcgca
tcccaccacagcttcatcggctacccgcccggctaccccatgcaagcctacgtagacccc
agcaaccccaacgccggcaaggtgctgctgcccacccccaccatggactccatgtgctcg
ccggcgccctacgagcacccgcagactttggtcgggcacacggtagaacccaccttaact
actcctcagccggtacctgtcgtccaacatgtagcaacccccatggaggtgacaaccccg
cagtatgtagcgcaaagtgacgctgtggtccatcaggaagccaacgtggccgtcctgcct
gtggctacagcgggagcggtgcagagccagagctacggcgtgtgggactcggcccagcag
cccgtggccgttccacagcagtactcgcccgcacagtcccaaacggccatttattaccaa
ggacagacctgtcagacggtgtacggtgtgacgtccccctactcgcagacgaccccgccg
attgtccagagttatgcccaaccaagtctccagtacatccagagccagcagatctacacg
gctcatccgcagggagtcatcgtgcagcccccgacggccgtgaccaccatcgtggcggcc
gggcagccgcagcccatccagcagccagagcttgtggtgaccaataacctcctggacttg
cctccaccatcccctccaaaacccaaaaccatcgtcctcccacccaactggaaaacagct
cgagatccagaggggaagatctactactaccacgtggtaacgaggcaaacccagtgggac
cctccaacctgggacagcccgggggatgacgccagcctggaacacgaagctgagatggac
ctggggaccccaacgtacgatgagaaccccatgaagtcttccaagaaagccaagacggcc
gaagccgacacgtccagcgagctggccaagaagagcaaggaggtgttcaggaaagagatg
tcgcagttcatcgtgcagtgcctgaacccctatcgcaaacccgactgcaaggtggggcgc
atcaccaccaccgaggacttcaaacacctggcgcgcaagctgacccacggcgtcatgaac
aaggagctgaaatactgcaagaacccggaggatctggagtgcaacgagaacgtcaagcac
aagaccaaggaatacatcaagaaatacatgcagaaattcggggccatctacaaacccaaa
gaggacacggacctggagtga

DBGET integrated database retrieval system