KEGG   Columba livia (rock pigeon): 102098246
Entry
102098246         CDS       T02912                                 

Gene name
SHISA5
Definition
(RefSeq) protein shisa-5
  KO
K10135  scotin
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102098246 (SHISA5)
SSDB
Motif
Pfam: Shisa
Other DBs
NCBI-GeneID: 102098246
NCBI-ProteinID: XP_021152146
LinkDB
Position
Unknown
AA seq 251 aa
MLQEGSLQLVQRAGNGDSTWEFQLRSWCDRGEPVWGEGCLQYVDRHGKTQPAKSCPDFCC
GDCRHQYCCSDVFLKFGEEQQFQCNLLGGRSTDLSNVNYMRVFSDPDDDIPGPSFGTFVA
IGIGIFAVIAVTLILCLTCSCCCLYKACRRPRPVVTTTTATTVVHAPYPQQQGVPPSYPV
APYQGYQPVAIQPQPGMPAAPYPAQYPPPYPMQPSGPPAYHETMAAGAGAPYPVSQPPYN
PAYMDPQKPVY
NT seq 756 nt   +upstreamnt  +downstreamnt
atgctgcaagaaggaagccttcagttggtacagagagcagggaatggggactccacttgg
gaattccagctgaggagctggtgtgaccgaggagagccggtttggggtgagggttgtctg
caatatgttgatcgtcatggcaagacacaacctgcaaaatcctgtcccgacttctgctgc
ggagattgcaggcatcagtactgttgctcggatgtgttcttgaaatttggtgaagaacaa
caatttcagtgtaatctgcttggtggaaggagcactgacttgagcaatgtaaattacatg
cgggttttttcggaccctgatgatgacattcctggccccagttttggaacctttgttgcg
attggaattggtatttttgcggtgattgcagttactcttattctgtgcctcacctgctca
tgttgctgtttgtataaagcatgtcgaagaccacggcctgttgtcaccaccacaacggcc
acaacggtggttcatgctccatacccccaacaacagggagtgccacccagctacccagtc
gccccgtatcaaggataccagccagtggccatccagccacagccgggcatgccggcagca
ccctaccctgcacagtatccccccccttaccccatgcagccgtcaggacccccagcttat
catgagacgatggcagctggtgcgggagcaccgtacccagtcagccagcccccgtacaac
cctgcttacatggatcctcagaagcccgtctattga

DBGET integrated database retrieval system