KEGG   Columba livia (rock pigeon): 102098310
Entry
102098310         CDS       T02912                                 

Gene name
TSC2
Definition
(RefSeq) LOW QUALITY PROTEIN: tuberin
  KO
K07207  tuberous sclerosis 2
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04140  Autophagy - animal
clv04150  mTOR signaling pathway
clv04218  Cellular senescence
clv04910  Insulin signaling pathway
clv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    102098310 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102098310 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102098310 (TSC2)
   04218 Cellular senescence
    102098310 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102098310 (TSC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102098310 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:clv01009]
    102098310 (TSC2)
Protein phosphatases and associated proteins [BR:clv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102098310 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Telomere_reg-2 Cnd1
Other DBs
NCBI-GeneID: 102098310
NCBI-ProteinID: XP_013224697
LinkDB
Position
Unknown
AA seq 1847 aa
MFERSDLGSALLSAMAKPQSKDSGLKEKFRNLLGLGTSRGSSKSSEGKQTEFIITAEILK
ELSIECGLSNRIRAIGQICEVAKTKKIEEHAVEAIWRVVADMLQPERPVEARHAVLHLLK
SIIQGQGERLGILRAHFFRVIKDYPSNEDLHERLEVFKALTENGRYITYLEEELADFVLQ
WMDVGLSSEFLLVLVNLVKFNSCYLEDYVADMVHKICLLCIQTSSSMDIEISLQVLDAVV
CYNCLPSENLPVFIITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRAYM
ADAALLRGAVFFVGMALWGAHRLSSLKNSPTSVLPSFFKAMTCPNAVVSYEIVLSITRLI
KKYGKELQAVTWDILLDIMERLLQQLQSLESQELKSIVHDLLTTVEELCDQNEFHGSEER
FFELVERCADQRPESSVLNLITYRAQSIHPAKDGWIHNLQMLMERFFRNESRSAVRIKVL
DVLSFVLSINRQFYEEELINLVVISQLAHIPEDKDHQVRKLATQLLVDLAEGCNTHHFNS
LLDIIEKVAARSLSSPSELEERDLLSYSASLEDVKTAVLGLLIILQTKLYSLPSSHAMRV
YEMLIQHVQRHYMYAYSLPVASSIRLQXFQCLLCYXXXXXXXLHRLGLANKDGAVRFSPY
CLCDFVEAEKRTSEKKPAGTLSPPAGSPSGPAQNATIRIGHLPYSMVFGVLLQCLKLETD
WKVLKLVLNKLPESLHYKVLFLTSPCNIDLLASALSYMLTDKKTTDRLHGTPEGFSRTDL
HLAVVPVLTALISYHNYLEKAKQREIVYCLEHGLIYRCANQCVVALSVCSVEMPDIIIKA
LPVLIVKLTHISATANVAIPLLEFLSTLARLPHLYRNFAVEQYASVFAISLPYTNPSKFN
QYIVCLAHHVIAMWFIRCRLPFRKGFVTYITKGLRSNALLSFDDTPEKDSFRARSTSLNE
RPKSLRLAKNAKQGLNNSPPVKELKESSAVDAFRSRSISVSEHVVRSRIQTSITSSSLGS
ADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLV
GNKLVTITTSVGTGTRSLLGLDSGELQSSTESSSDPVLQVRQTKEAPAKLESQAGQQVCR
SSRNRVRSMSGGHALRVGALDSSASHLPAGSVSQGTQSPPAPAPRSEKTNPAPQTSLQKE
KANLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAE
RFKEHRETALYKSLSVPSSSLATGTAKPSLLQRSNTVASFSSMYQSSCQGKLHRSISWAE
SAVVLEEGSPSETELKETESPAESPESEDIETSCSEQVLSEERFGKPQESYSRSSSTSSQ
EEKSLKSEDLVEGGIPIGRVLPSEDGQTLEELSFQPSQPLSKSSSSPELQTLQEVLKDAN
GREGPRRLSTEVKSKSQSGNLEGEGLGSWLGKGEDARATGSGGLDGTAPVTSPRSPSGLR
PRGYTISDSAPSRRGKRIERDAFKSRTAASNAEKVPGINPSFVFLQLYHSPFFGDENNKP
LLLPNETFERSVQLLDQIPSYDTHKIAVLYVGEGQSNNEIAILSNEHGSYRYTEFLTGLG
KLIELKDCQPDKIYLGGLDVCGEDGQFTYCWHDDIMQAIFHIATLMPTKDLDKYRCDKKR
HLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIITPLDYDCNLVTLQCRKDMEGLVDTSV
AKVISDKNLPFVARQMALHANMASQVHHSRSNPTDTYPSKWIARLRHIKRLRHRLREETQ
YQTPGLPLQMHAPAKPPPQAPQDPPPAYETGQRKRLISSVDDFTEFV
NT seq 5544 nt   +upstreamnt  +downstreamnt
atgttcgaacgctcagatttgggctcggcactgctgtcagccatggcaaagcctcagagc
aaggattccggactgaaggagaagttcaggaatctcctggggctgggaacgtcccgggga
agttcaaagtcatcggagggcaagcaaacggagtttatcatcactgcggaaatactcaag
gaactgagcatagaatgtggattaagtaataggatacgagcaatcggtcaaatttgtgaa
gtggcaaaaacaaaaaaaattgaagagcacgcggtggaagccatatggcgagtggtggcc
gacatgctgcagcccgagcgccccgtggaagccagacatgctgttcttcatctgctgaag
tcgatcattcaaggacagggcgagagattagggatcctcagagcacatttttttagagta
attaaggactatccctccaatgaagacttgcatgaacggctggaagtgttcaaggctcta
acggagaacggacgatacatcacctacttggaagaagagctggctgactttgtactgcag
tggatggatgttggtttgtcttccgagttcctcctggttttagtgaacctggtgaaattc
aatagctgctatctggaagactatgtagctgacatggtccacaagatatgcctcttgtgt
attcagacttcatcatctatggacatagagatttccttgcaagtcttggatgcagttgtt
tgctacaactgtctgccgtcagaaaacctgccagtgttcatcatcaccctgtgccggacc
atcaacgtgaaggagctctgcgagccctgctggaagcttatgcgcaaccttttgggaact
catttgggacacagtgccatctacaacatgtgccggatcatggaagacagagcatacatg
gcggatgcagcattgctgagaggagccgtgttctttgtcgggatggctctgtggggtgct
catcgcctcagttctctcaagaattccccaacttcagtgctgccttcattcttcaaggcc
atgacgtgtcccaacgcggttgtatcttatgagatagttctgtccataacacgtctaata
aagaagtatgggaaggagctgcaagctgtgacatgggacatccttttggacatcatggag
cgattactgcaacagctgcagagtctggagagccaagaacttaagtccattgtacatgat
cttttgactacagtagaagaactttgtgaccagaatgaattccatggctctgaagagaga
ttttttgagctggtggaaagatgtgctgatcagagaccagaatcttctgtactaaacttg
ataacatacagagctcagtccattcatcctgccaaagacggctggattcacaacctgcag
atgttaatggagagattcttcaggaacgaaagtcgtagtgctgttcgcattaaagttctg
gatgtcttgtcctttgtcctgagtattaacagacagttctatgaggaggagctgataaac
ctggttgtgatctcgcagctggctcacattccagaggataaagaccatcaagttcgaaaa
ttggccactcagctgctcgtagacctggctgaaggctgcaacacccatcactttaatagc
ctgctggatatcatagaaaaggtggctgcacgttctctctcatctccttctgaactggaa
gagagggacttgctatcgtattcagcttctttggaggatgtcaagacagcagttcttgga
ctcctgataattcttcagacaaaactctacagcctaccctccagccatgccatgcgggtg
tacgagatgctgattcagcacgtccaacgccattacatgtacgcgtacagccttcctgtc
gccagcagcatcagactgcagtgattccagtgtcttctctgttacannnnnnnnnnnnnn
nnnnnccttcaccggcttggacttgccaacaaggatggagcagtgaggttcagcccttac
tgtctgtgtgattttgtagaagcagagaagaggacttctgagaagaagcctgcgggtacg
ctctctccgcccgcgggcagccccagcgggcctgcccagaacgccaccatccgcatcggc
cacctgccctactccatggtcttcggtgtcctcctccagtgcctgaagctggagacagac
tggaaggtgttgaagttggtcctcaacaagttacctgaatccctccactataaagtgcta
tttttaacctctccttgtaacatagacctgctggcttctgcactgagctacatgctcaca
gacaaaaagacaaccgacaggctccatgggaccccagaaggcttttcccgcactgatttg
catctggctgtagttccagtactgacggcattaatatcttatcacaattatctggaaaaa
gccaaacagcgtgaaatagtgtattgcctggaacacggtcttatttatcgctgtgcaaac
caatgcgttgtggcgctctctgtctgcagcgtcgagatgcccgatatcatcataaaggcg
cttccagtcttaatagtcaaattaacccacatttccgctacagccaacgtggcaatccct
ctcttagaatttctttcaactctggccaggctgcctcacctctaccggaactttgcggta
gagcagtacgccagtgtgtttgccatctccctgccctacacaaacccttccaagtttaac
cagtacatcgtttgcctggcccatcacgtgatagcgatgtggttcattcggtgtcgcctt
cccttccgaaagggctttgtgacctatattacaaagggtttgcgctccaatgcccttctt
tcctttgacgacacgccagagaaggacagtttcagggctcgcagcacaagcctgaatgag
aggcccaaaagtttaagactagccaaaaatgcaaagcaaggcttgaataactctcctcca
gtgaaagagctgaaagaatcctctgcagttgatgccttccgatcccgcagcatcagtgtg
tctgaacatgtggtccgcagtcggatacaaacatccatcactagttcaagcctgggctct
gcggatgaaaattcaatggctcaggctgacgacaacttaaaaaatctccacctggaactc
acggagacctgtctggacatgatggctcgatacgtcttttcaaacttcacggcggtgcct
aaaaggtctcctgtgggcgagtttctgctggctggaggaaggacgaagacgtggctggtt
ggtaacaagctggtgaccatcactacaagcgtcggaacagggacaaggtccctgcttggc
ttagactctggagaactccaaagcagcacagaatcaagctcagaccctgttttgcaagtg
agacaaactaaagaagctccagcaaaactggaatcccaagccgggcagcaggtttgcaga
agctctcgcaacagagtccgatccatgtcgggtggtcatgccttacgtgttggggcttta
gacagctcagcctcccatttgcccgccggctccgtttcccaagggacacagagtcctcct
gctcctgcacctcggtcagagaagactaatcctgctccgcagacgtctctgcagaaagaa
aaagcaaacttagctgcatatgtcccactgctgacacagggatgggcagaaatcctcgtg
cgcagacccacaggtaacaccagctggctgatgagcctggagaacccgctcagtccgttc
tcttcagatatcaacaacatgcccctgcaagagctctccaacgcgcttatggccgcagag
cgttttaaagaacaccgcgaaacggctctgtacaaatccctgtctgtcccctcgtccagc
ctggccaccggcacagccaaaccgtctcttctccagcggtccaacacagtggcctctttc
tcttccatgtaccagtccagttgtcaagggaagttgcacaggagcatatcctgggcagag
tcggcggtggtgctggaggaagggagcccgtcagaaacggagctgaaggaaaccgagtcc
ccagctgagtctccggagagcgaggacattgagacttcatgttctgaacaagtcctgagc
gaggaaaggtttggtaaaccccaggagtcttacagcaggtcctcctcgacctccagccaa
gaagaaaaatctctgaagtcggaagacctggtggagggtggaattcccatcgggagggtc
ctgccatcggaggacggccagacactggaggaactctccttccagccgtcccagccgctc
agcaagtccagttcttcccccgagctacagacgctgcaagaggtcctcaaagatgccaac
ggcagagaaggaccaaggaggctgagcacagaagtcaaatcaaagtcccagtctgggaac
ctggaaggggaagggctgggcagttggctgggcaagggggaggatgccagagccacaggg
tcaggggggctggatggcaccgctcctgtcacctcccctcgctccccctcgggcctccgg
ccccgcggttacaccatctcagactcggccccgtcccgaagaggaaaaaggatcgagaga
gatgccttcaagagcagaacagcagcctccaacgctgagaaagtgcccggaataaaccca
agctttgtgtttttgcagttgtaccactccccattctttggtgatgaaaacaacaagcca
cttttgctgccaaatgagacctttgagagatcggtgcagctcctggatcaaattccttct
tacgacacacacaagatcgcggtgctctacgtcggagaagggcagagcaacaatgaaatt
gcaattctgtcaaacgaacacggatcctatcgctacacggagttcctgaccgggctgggg
aagctcattgagctcaaagactgtcagccagataaaatttacctcggtggcctggacgtg
tgtggggaggatggacagtttacctactgctggcacgatgacattatgcaagccattttc
cacatcgctaccctgatgcccacaaaggatttggataaatatcgctgtgacaagaaaagg
cacctcgggaatgattttgtttctattgtttacaatgattctggagaagactttaagctg
ggaacaataaagggtcagttcaactttgtgcatgttatcatcacacctcttgactatgac
tgtaacctggtgacgctgcagtgtcggaaagacatggagggtctcgtggacacgagtgtc
gccaaggttatctctgacaagaacctgccgtttgttgcccgtcagatggctctgcacgcc
aacatggcttcccaggttcatcacagtcggtcaaaccctactgacacctacccatccaaa
tggatcgcgaggctcaggcacatcaagcgtctcaggcaccggctacgtgaagaaacccaa
taccagactcctgggctgcccctgcagatgcacgccccggcgaagcccccaccccaggct
ccccaggaccccccgcccgcctacgagactgggcagaggaagcgcctcatctcctcggtg
gacgacttcaccgagttcgtgtag

DBGET integrated database retrieval system