KEGG   Columba livia (rock pigeon): 102098736Help
Entry
102098736         CDS       T02912                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain isoform X1
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102098736 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_core Transglut_C
Motif
Other DBs
NCBI-GeneID: 102098736
NCBI-ProteinID: XP_021157010
LinkDB All DBs
Position
Unknown
AA seq 595 aa AA seqDB search
MSETMNTNEERKPPLNGRRALPSNNSNEEENEVPEMEAFGLIPRGFNPKDYLRVVDIQMF
KEPHEINKQQHHTDKYYSPKLIVRRGQLFQIQVDFNRPYNPETDQFWLEYLIGRYPQQNK
GTYIPILVGDVLKPGEWGAKITHKENNSVRLSIMSSATCIVGKFRLYVAVWTPFGILRTR
RNSATDTYILFNPWCQQDAVYMDDEKEREEYVLNDVGIVFHGNINDIKLRSWSYGQFEEN
ILDACLFLMDKAELELSGRGNPIKICRVASAVINSKDDNGVIAGSWDNTYTYGVAPSAWT
GSVDILLEYYSSKQPVRYGQCWVFAGVFNTFLRCLGIPARLITNYSSAHDNNANLRLDFF
LDDEGKVDTKLTKDSIWNYHCWNEAWMTRPDLPVGFGGWQVVDGTPQETSDGMYRCGPAS
VQAIKHGHVCFQFDAPFVYAEVNSDIVYSRREKNGTQVIEKIDTTHVGQLIVTKEVGGDG
MMEITEDYKFQEGSKEERLALETAVMYGVKKQTTQDIVYQPQTDVDMDFQVQKAVIGSDF
KVTITFRNKSRNHYTATTYLSGNIVFYTGVTKNEFKXXXXXXQNWHPLHRALLML
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacaatgaataccaatgaagagaggaaacctcctctgaatgggagaagagcc
ctcccatcaaacaactctaatgaagaagaaaatgaggtccctgagatggaggcttttgga
ttgatacctagaggatttaatccaaaagattacctgcgtgttgtggatattcagatgttc
aaggagccccatgagatcaacaagcagcagcaccacactgacaagtactacagccccaag
ctgatagtgcgtcggggacagcttttccaaatccaagttgacttcaaccggccctataac
ccagagacggaccaattctggctggagtatttgataggtcgctacccgcagcaaaacaaa
ggcacctacatcccgatcctggtaggtgatgtactgaaacctggcgagtggggagccaag
attacccacaaggagaacaactctgttcgcctgtccatcatgtcctctgccacctgcatt
gttgggaagtttcgcctgtatgttgctgtctggactccctttggcatcctccggacacgc
agaaactctgcaacagacacttacatcctgttcaatccatggtgccagcaagatgctgtg
tatatggatgatgagaaagaaagggaagaatacgttctgaatgatgttggtattgttttc
catggaaacatcaatgacatcaaattaagaagttggagttatggtcagtttgaagaaaac
attctggatgcttgcctgttcctgatggacaaggcagaactggagctctctggacgtgga
aacccaataaaaatctgccgtgttgcctctgcagtgatcaattccaaggatgataatggt
gtgattgctggatcctgggacaatacatacacttatggagtcgcaccttcagcctggact
ggaagcgtggacattctcttggagtattatagttctaagcaaccagtgcgatacggccag
tgctgggtctttgctggtgtcttcaacacatttctgaggtgcttggggatacctgcaaga
ctcatcaccaactattcttctgcccatgataacaatgccaatttacgtttggacttcttt
ctggatgacgaagggaaagtggacaccaaacttacaaaagactccatctggaactatcat
tgctggaatgaagcttggatgaccagacctgatcttcctgttggttttggaggatggcag
gttgttgatgggacaccccaagaaaccagtgatggtatgtacaggtgtggcccagcctca
gttcaagccattaaacatggtcatgtttgcttccaatttgatgctccttttgtctatgcc
gaggtgaatagtgacattgtttactcaagaagggagaaaaatggaacccaagtgatagaa
aaaattgacacaacccacgttgggcagttgattgtgaccaaggaagttgggggtgatgga
atgatggagattactgaggactacaagttccaagaaggctcaaaggaggagagactggct
cttgagactgctgtgatgtacggcgttaaaaagcaaactacccaagacatcgtgtatcag
ccacagacagatgttgacatggacttccaagtgcaaaaggcagtcattggcagtgacttc
aaagtcactataactttcaggaacaaaagtcgcaaccattacactgctactacatacctt
tctggcaacatagtgttttacacaggagtcacaaaaaatgaattcaagaannnnnnnnnn
nnnnngcaaaactggcaccctcttcatcgagcgcttttgatgttatga

DBGET integrated database retrieval system