KEGG   Columba livia (rock pigeon): 102098952
Entry
102098952         CDS       T02912                                 

Gene name
GRB2
Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04012  ErbB signaling pathway
clv04068  FoxO signaling pathway
clv04150  mTOR signaling pathway
clv04510  Focal adhesion
clv04540  Gap junction
clv04910  Insulin signaling pathway
clv04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102098952 (GRB2)
   04012 ErbB signaling pathway
    102098952 (GRB2)
   04068 FoxO signaling pathway
    102098952 (GRB2)
   04150 mTOR signaling pathway
    102098952 (GRB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102098952 (GRB2)
   04540 Gap junction
    102098952 (GRB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102098952 (GRB2)
   04912 GnRH signaling pathway
    102098952 (GRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clv04131]
    102098952 (GRB2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:clv04990]
    102098952 (GRB2)
Membrane trafficking [BR:clv04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    102098952 (GRB2)
Domain-containing proteins not elsewhere classified [BR:clv04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   102098952 (GRB2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH2 SH3_2 SH3_10 SH3_3 SH2_2 hSH3 DUF5093 SH3_4
Other DBs
NCBI-GeneID: 102098952
NCBI-ProteinID: XP_005503133
LinkDB
Position
Unknown
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFILKNYIEMKPHPW
FFGKIPRAKAEEMLGKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEEGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNRNI
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaagccatcgccaagtacgacttcaaagccaccgcggatgacgagctgagcttcaaa
cggggggatatccttaaggttttgaatgaagaatgcgatcagaattggtacaaggcagaa
ctcaatggaaaagacggcttcattctcaagaactacatagaaatgaaaccacatccgtgg
ttttttgggaagattccccgagcgaaggctgaagagatgttgggcaaacagagacacgac
ggtgccttcctcatcagggagagcgagagcgctccgggggacttctccctctccgtcaag
tttggaaatgatgtgcagcacttcaaggtgcttagagatggggctggcaagtatttcctc
tgggtggtgaagttcaattctttgaacgagctggtagattatcacagatccacatctgtc
tccaggaaccagcaaatatttctccgggacattgaacaggtgccacagcaaccaacgtac
gttcaggccctgtttgatttcgatccccaggaggaaggagagctgggtttccgccgcgga
gactttatccaagtccttgacaattctgaccccaactggtggaagggagcctgccacgga
cagacgggcatgtttccacgcaactatgtgaccccagtgaaccggaacatctag

DBGET integrated database retrieval system