KEGG   Columba livia (rock pigeon): 110365053
Entry
110365053         CDS       T02912                                 

Gene name
ADGRB1
Definition
(RefSeq) brain-specific angiogenesis inhibitor 1
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    110365053 (ADGRB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:clv01002]
    110365053 (ADGRB1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clv04131]
    110365053 (ADGRB1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:clv04030]
    110365053 (ADGRB1)
Peptidases and inhibitors [BR:clv01002]
 Mixed peptidases
  Family P2
   110365053 (ADGRB1)
Membrane trafficking [BR:clv04131]
 Endocytosis
  Phagocytosis
   Others
    110365053 (ADGRB1)
G protein-coupled receptors [BR:clv04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   110365053 (ADGRB1)
SSDB
Motif
Pfam: 7tm_2 TSP_1 GAIN TSP1_spondin TSP1_ADAMTS GPS TSP1_CCN
Other DBs
NCBI-GeneID: 110365053
NCBI-ProteinID: XP_021154691
LinkDB
Position
Unknown
AA seq 1389 aa
MEQGLQQGGWNPWSSWGDCTKDCGGGLQTRMRTCKPLPNEGLVCEGVLEEGRLCNRKACN
TNGRYNSRSQSLRSTDNRKREDTDELQHYGYPAPQIGDPAAEEWSPWSVCSTTCGEGWQT
RTRFCVSSSYSTQCSGPLREQRQCNNSAVCPVHGTWDEWSPWSLCSSTCGRGYRDRTRTC
KPPQFGGNPCEGPEKQTKFCNIALCPGHSVDGNWNEWSSWSSCSASCSNGTQQRTRECNG
PSYGGAECQGHWVETRDCFLRQCPVDGKWQAWGVWGSCTTTCGGGTQRRDRMCYGPFFGG
ETCQGPKEEYKQCKNFAFLAEPHEICDEESLGSVVWKETPAGDAAAVRCPRNATGLILRR
CILDEEGIAYWEPPTYIKCVSIDYRNIQMMTREHLSKAQRGLMGDGLSEVLQNLVEISQD
GTSYSGDLLSTIDVLRNMTEIFRRAYHSPTSGDVQNFVQIISNLLSEENRDKWEEAQLIG
PNARELFRLVEDFIDVIGFRMKDFRDSYQVTDNLAXXXXXXXANAATDITFPMKGWRGMV
DWAKNSEDKVTVSKSILSSGLTETDDSSVFVVGTVLYRNVGNILSLQRNSTVLNSKVISV
TVKPFPRSLLTPLEIEFSHLYNGTTNQTCILWDKTVGRASASASPPGAWSWRGCRTVPLD
ASRTKCLCDRLSAFAILAQLSPDMNMEKVLVPSVTLIVGCGVSSLTLLLLIIIYVSVWRT
QVFPCLGYHWMCSSPCPLLLFLRLGSTGQRWYIRSERSVILINFCLSIISSNALILIGQT
QTRNKVICTLVAAFLHFFFLSSFCWVLTEAWQSYMAVTGRLRNRIIRKRFLCLGWGLPAL
VVAISVGFTKAKGYGTVNYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGI
TDKKLKERAGQMAVPLYGMTLKCSKCGVVSSAEVSATATSNAMASLWSSCVVLPLLALTW
MSAVLAITDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVVDRQEEGNGDS
GGSFQNGHAQLMTDFEKDVDMACRSGEHITVLNKDITTCRTSTITGTLKRPSLPDEEKLK
LNHQKGSSNFNSLPANVSKMHLQGSPHYLGAINLNEFSNHSLTLKKDKNQPPKSIYICDG
DIFKKLDSELSRAQEQTLDTSYVILPTNTSTLRAKPPKDESKYSINIDQMPQTRLIHLSM
ATDPGFVVKSPPREPVTMTCTEVQGSPMIQQQQQLAPQNIPSESQIPNSLCDTGDSGNSG
VVSKSETVSTLSMSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKLQHAEKEKESPT
TDSKQEKQQTPNKRPWEGIRKVQSPPSWVKKDIEPVAQSPLELKTVEWEKTGATIPLVGQ
DIIDLQTEV
NT seq 4170 nt   +upstreamnt  +downstreamnt
atggaacagggtctccagcaaggtggttggaacccatggtcgtcttggggtgactgcacc
aaggactgcgggggaggcctgcagacccggatgcgaacctgcaagccccttcccaatgaa
ggtcttgtctgcgagggagtcctggaggaaggacggctgtgcaataggaaggcgtgcaat
accaatggacgctataattccagaagccaatcgctgaggtccacagataacagaaagcga
gaggacactgatgaactgcagcactacgggtaccctgcacctcaaataggtgaccctgca
gcagaggagtggtccccatggagcgtgtgttcaaccacctgtggggagggctggcagacc
aggacgaggttctgtgtgtcgtcttcctacagcacccagtgcagtggtcctctccgggag
cagagacagtgcaacaactctgccgtgtgcccagtgcatggcacctgggatgagtggtct
ccatggagcctgtgctcttccacgtgtggaagagggtacagggaccggacccggacatgc
aaacccccacaatttggtgggaacccctgtgagggcccagagaagcaaaccaagttctgc
aacattgcactttgcccaggccactcagtggacggcaactggaatgaatggtcgagctgg
agctcctgctcagcctcctgctccaacggtacccagcaacggacaagggagtgcaatgga
ccttcctatgggggagctgaatgccagggacactgggtggaaaccagggactgcttccta
cgtcaatgcccagtggatgggaagtggcaggcttggggagtgtggggcagctgcaccacc
acgtgtggaggtgggactcagagacgtgaccgcatgtgctacggacccttcttcggtgga
gagacttgccagggccctaaggaagaatataagcagtgcaagaattttgccttccttgca
gagcctcatgaaatttgtgatgaggaaagtcttggttctgtagtttggaaagagacacct
gctggggatgctgcagctgtccgctgtcctcgcaatgccaccgggctgatccttcgaaga
tgcattttagatgaagaaggaatagcttattgggagcctccaacatacatcaagtgtgtt
tctattgattacaggaacatacagatgatgaccagggaacatctttccaaagctcagcgt
gggttgatgggagatgggctatcagaagtactccaaaaccttgtggaaatctctcaggat
gggaccagctacagtggggacttgctgtccaccatcgatgtactcaggaacatgacagag
atcttccgtagggcttatcatagcccaacttctggggacgtgcagaactttgtccagatc
atcagcaatcttttatcagaggaaaaccgagacaaatgggaggaagctcagctgataggg
ccaaacgccagggagttgttcaggcttgtggaggatttcattgatgtcattggctttcgc
atgaaagatttccgggattcctaccaagtgacggacaatctggcttnnnnnnnnnnnnnn
nnnnnngctaatgcagcaactgacatcaccttccccatgaaaggctggaggggcatggtg
gactgggccaagaattcggaggacaaggtcactgtctccaaaagcatcctgtcttcaggg
ctgacagagacagacgactcctccgtcttcgtggtggggaccgtgctgtaccggaacgtg
ggcaacatcctctccctccagaggaacagcactgttctgaactccaaagtcatctccgtg
actgtgaagccatttcctcggtctctcctcacacccctggaaattgaattctctcacctg
tacaatggaaccaccaaccagacctgcatcctgtgggacaaaactgttggcagagcctcc
gcctccgcctccccgcccggcgcctggtcctggcgcggctgccgaacggtcccgctcgac
gcctcccggactaagtgcctgtgtgaccggctctccgccttcgccatcttagcccagctc
agccccgacatgaacatggaaaaggtgctggtcccctctgtcacattaattgtaggctgt
ggagtatcttcgctgacacttttgctgttgattatcatttatgtctctgtttggagaact
caggtttttccgtgcctggggtatcattggatgtgctcaagtccctgtcctctcctgctt
ttcctcaggctgggcagcactgggcagcgctggtatattcgctcagagcgctctgtcatt
cttatcaacttctgcctatccatcatctcctccaacgctctcatcctaatcggacaaacc
cagacccggaataaggtgatttgcacgctggtggcagctttcttgcacttcttcttcctc
tcctctttctgctgggtgctgaccgaggcttggcagtcctacatggccgtgacgggccgg
ttacggaatcgcatcatccgcaagcgcttcttgtgtctcggatgggggctccctgccttg
gtggttgccatttctgtgggatttactaaagccaaggggtacggcaccgtgaactactgc
tggctgtcattagagggaggtcttctctatgccttcgtgggaccggcggctgctgtcgta
ttggtgaacatggttattggcattctggtttttaacaaacttgtatccaaagatggaata
acagataagaaactgaaggaacgggcaggtcagatggcagtgcccctttacggcatgacg
ctcaaatgttccaagtgtggagtagtttcttctgctgaagtttcggccacagccaccagt
aacgccatggcatctctttggagttcctgtgtggtcctacctctcctggctctcacctgg
atgtctgcagtactggcaatcacagatcggcggtcagcactcttccagatcctttttgcc
gtctttgactcattggagggttttgtcattgttatggtgcattgcatcctaaggcgggag
gttcaggatgctgtgaagtgccgagtagtagatcgtcaagaagaaggcaatggagactca
ggggggtcatttcagaatggacacgctcagctaatgaccgattttgagaaggacgtggat
atggcttgtagatcaggtgagcacatcacagtgctgaataaagacatcaccacctgcagg
acctcaacgatcacaggaacattgaagcgtccatcactgccagatgaagagaaattgaaa
ctcaatcaccagaaggggtcatcaaactttaatagtcttccagccaatgtctccaagatg
catcttcagggctcaccacactacctgggggccatcaacctgaatgagttcagtaatcac
agtctcactctgaagaaggacaagaaccaaccacctaaatccatctacatatgtgatggg
gacatcttcaagaagttggactcagaactctcccgagctcaagagcaaacactggacacc
agctatgtcattctgcctaccaacacatctaccttacgggccaaaccacccaaagatgag
agcaaatacagcatcaatattgaccagatgccacaaacacgactcatccacctcagtatg
gctactgacccaggctttgttgtcaagagtcctccacgggagcctgtaaccatgacatgc
actgaggtgcaaggttcccccatgatacaacaacagcagcagctggcaccacaaaatatc
cccagtgagtcacagattcccaacagcctgtgtgacacaggtgactcagggaactcaggt
gtggtgtccaagagtgagaccgtctccaccctctccatgagctccttggagaggcggaaa
tcccggtatgcagagctagattttgagaaaatcatgcacacaagaaaacgtcaccaagac
atgttccaagacctgaacagaaaactccagcacgcagagaaggagaaggaatctccaaca
acggacagcaagcaagaaaaacagcagacaccaaacaagagaccctgggaaggaatcagg
aaagtccagtccccaccatcatgggttaaaaaggacatcgaacctgtggcacagtctccc
ctagaactaaaaactgtggagtgggagaaaacaggagccaccattcccctggtgggacaa
gacattattgaccttcagacagaggtctga

DBGET integrated database retrieval system