KEGG   Corynebacterium lactis: CLAC_01935Help
Entry
CLAC_01935        CDS       T04042                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
clw  Corynebacterium lactis
Brite
KEGG Orthology (KO) [BR:clw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:clw03012]
    CLAC_01935
   03029 Mitochondrial biogenesis [BR:clw03029]
    CLAC_01935
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clw04147]
    CLAC_01935
Translation factors [BR:clw03012]
 Eukaryotic Type
  Elongation factors
   CLAC_01935
 Prokaryotic Type
   CLAC_01935
Mitochondrial biogenesis [BR:clw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CLAC_01935
Exosome [BR:clw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CLAC_01935
  Exosomal proteins of breast cancer cells
   CLAC_01935
  Exosomal proteins of colorectal cancer cells
   CLAC_01935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ALA66692
UniProt: A0A0K2GY24
LinkDB All DBs
Position
465834..467024
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADTYPDLNQAFAFDAIDKAPEEKE
RGITINVSHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEEAPIVHISALKAL
EGDAKWAESIVELMQACDDNIPDPVRETDKPFLMPIEDIFTITGRGTVATGRVERGVLNV
NDEVEILGIKEKSQKTTVTGIEMFRKLLDSAEAGDNCGLLLRGIKREDIERGQIVAKPGA
YTPHTEFEGSVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNVD
MAVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKIVK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtacgaagccgcacgtcaacatcggtaccattggtcac
gtcgaccacggtaagaccaccaccaccgccgctatcaccaaggttctggctgacacctac
ccggacctcaaccaggctttcgctttcgacgccatcgacaaggcgccggaggagaaggag
cgcggtattaccatcaacgtttcccacgttgagtaccagaccgagaagcgtcactacgct
cacgtcgacgctccgggccacgctgactacatcaagaacatgatcaccggtgccgctcag
atggacggcgcaatcctggttgtcgccgctactgacggcccgatgccgcagacccgtgag
cacgttctcctggctcgccaggtcggcgttccgtacatcctcgttgctctgaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggaggtccgcgagcttctg
gctgagcaggactacgacgaagaggctccgatcgttcacatctccgctctgaaggctctc
gagggcgacgccaagtgggcagagtccatcgtcgagctcatgcaggcttgtgacgacaac
atcccggatccggttcgcgagaccgacaagccgttcctgatgccgatcgaggacatcttc
accattaccggtcgtggcaccgtcgctaccggtcgtgttgagcgcggcgtcctgaatgtc
aacgacgaggtcgagatcctgggcatcaaggagaagtcccagaagaccaccgtcaccggt
atcgagatgttccgcaagctgctcgactccgctgaggctggcgacaactgtggtctgctg
ctccgcggtatcaagcgcgaggacatcgagcgcggtcagattgttgctaagccgggcgct
tacaccccgcacaccgagttcgagggttccgtctacatcctgtccaaggatgagggcggc
cgccacaccccgttcttcaacaactaccgtccgcagttctacttccgcaccaccgacgtt
accggtgttgtgaccctgccggagggcaccgagatggttatgccgggcgacaacgtcgac
atggctgtcaagctgatccagccggtcgctatggacgagggcctgcgcttcgctatccgc
gagggtggccgcaccgtcggcgctggccgcgtcaccaagatcgtcaagtaa

DBGET integrated database retrieval system