KEGG   Corynebacterium lactis: CLAC_05695Help
Entry
CLAC_05695        CDS       T04042                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
clw  Corynebacterium lactis
Pathway
clw00010  Glycolysis / Gluconeogenesis
clw00520  Amino sugar and nucleotide sugar metabolism
clw01100  Metabolic pathways
clw01110  Biosynthesis of secondary metabolites
clw01120  Microbial metabolism in diverse environments
clw01130  Biosynthesis of antibiotics
clw01200  Carbon metabolism
Module
clw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:clw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLAC_05695
   00520 Amino sugar and nucleotide sugar metabolism
    CLAC_05695
Enzymes [BR:clw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CLAC_05695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ALA67296
UniProt: A0A0K2H0S1
LinkDB All DBs
Position
complement(1283394..1284149)
Genome map
AA seq 251 aa AA seqDB search
MTQRVGFGIDVGGSGIKGGRVDLDTGLLIGDRIKILTPKPATPDAVAKTIAEIVKIAQWD
GHVGITLPSVVQNQTALLAANIDGSWVNTDCQKLFSAHLPNNPAHVLNDADAAGLAEVQF
GNPENKTGSVMLLTFGTGIGSALIHDGKLYPNSELGHLVIDGTEAEHYASSKAKEDKDLS
YKKWAKRVSKVLSVYEALFWPSKFIVGGGISRKHEKWVPLLTCKTPVEPATLHNNAGIAG
AALAAEQGLYP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacgagttggatttggtatcgacgtcgggggctccgggattaagggaggccgg
gttgacctcgacacgggtctcctcattggcgatcgcatcaagattttgacgccaaaaccc
gcgacccccgatgctgtggcaaaaacaatcgcggaaattgtgaagattgcgcagtgggat
ggccacgtcggaattacactgccctcggtggtccagaaccagacagcacttctcgccgca
aacatcgacggttcctgggtaaataccgactgccagaagcttttctctgcccacctaccc
aataacccagcgcatgtgcttaacgacgccgatgccgccggccttgccgaagtacagttc
ggcaacccagagaacaaaacgggatccgtaatgctcctgacattcggcactggaatcgga
tctgcgctaattcacgatggaaaattgtacccgaattccgaactcggccatttggtgatc
gatggcacagaagctgagcattatgcctcctccaaggccaaggaggacaaagacctcagc
tacaagaagtgggcgaagagagtttcgaaggtgctctcggtgtatgaggcactcttctgg
ccatccaagttcattgtgggtggcggcatcagccgtaagcatgagaaatgggttcctctg
ctgacctgtaagactccagtagaaccggcgacactgcacaataacgccggaatcgcagga
gcagcattggcggctgaacagggactttacccctaa

DBGET integrated database retrieval system