KEGG   Corynebacterium lactis: CLAC_07630Help
Entry
CLAC_07630        CDS       T04042                                 

Definition
(GenBank) hypothetical protein
Organism
clw  Corynebacterium lactis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANAPC3 GvpG
Motif
Other DBs
NCBI-ProteinID: ALA68577
UniProt: A0A0K2H3G5
LinkDB All DBs
Position
1709703..1711478
Genome map
AA seq 591 aa AA seqDB search
MAEDGLMAWWDIEDDAWPQAPEAPGTSGAPSVRDDVLGGSAVARADAAPLPIAPRYPDRQ
PQPVPESLGELLRFSRAAGASLDHVSSWRAVSAFARNFWLEDSPASDADNIGEFYALRHA
VADQLELVDEAATARAEWLAWAEHSGIYPAILHARSYMAFAEAEAFIDANPGDILTGARP
TGADVPELVSLADDIVAVSPDPAQAYHYVLSAAVAGAAASLARRPDIAQKLSEWTSRWAP
KRSGHDDRKLLAAQLAHGRGELRTAARIAAEVASAPQSEPVTTTIEARQFLAYLSLEAGE
DAEAIRQLRPIVKAGLELDLTVGVLRSVRLLAALLNSAGEFAEAAEVAHSALESADSMPL
CPMRMDIQLILARSLLDLDSPEQALRFAEPVAHWSTLTDDEERTDAAFSIAAAAAGLAGD
EARSVALLVDHGEHLQRLGDFRGAAKSYRQAARSQINAAAIPGSAGSSALDLDTALEAAE
SLMNRSRALIDATNHWDLADWHDDLAFIYYSSARDSLALAHVETAANGYLAAGDGEESAR
ALLTGLQVSLDSGDTVTAEFYARRVEELLPRAQWEGHPVLDALDRLVEGER
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaagatggtctgatggcgtggtgggatattgaagatgacgcgtggccgcaggcc
cccgaagcacccggaacatccggggctcctagcgtccgagacgatgtgctcggcggcagc
gcggtagctagggcggacgcggcgccgctgcctatagcgccccgttaccccgaccggcag
ccgcagccggtcccagaatccctcggcgagctcctgcggttttcccgtgccgccggggcg
agcctggaccatgtctcgagctggcgcgctgtcagtgcctttgcccgaaacttctggctg
gaggactcccctgcctcggacgcggataacatcggcgagttctatgctctgcgccatgcc
gtagcggaccagctcgagctggtcgacgaggccgcgaccgcccgcgccgagtggctcgcc
tgggccgaacactcgggcatctaccccgcgattttacacgcgcgctcctacatggccttc
gccgaggcggaggccttcatcgatgcgaacccgggcgatattctcacaggcgcccgtccc
acgggcgcggacgtccccgagctggtttcgcttgccgacgacatcgtcgccgtttccccc
gacccagctcaggcgtatcactacgtgttgtccgcagccgtcgcgggagccgcagcttcg
ctggcccggcgccccgacattgcgcagaagctatccgagtggacctcccggtgggcgccg
aagcgcagcggccacgacgaccggaagctgctggcagcccagctcgcccacggccgcggc
gaactacgcacggccgcacgaattgccgccgaggtcgcaagcgccccgcagtcggagccg
gtgaccacgaccatcgaggcccgtcaattcctggcctacctgtccttggaggccggcgaa
gacgcggaggcaatccggcagctgcgcccgattgtcaaggctgggctcgaattggatctc
actgtcggcgtgctgcgcagcgtgcgtttgctcgccgcactgctaaattctgcgggtgaa
ttcgccgaggcggccgaggtagcgcactcggcactcgagtccgcggactccatgccactg
tgccccatgcgaatggacatccaactgattctcgcccgcagcctgctggacttggatagc
cccgagcaggccctgcgcttcgcagagcctgtcgcccactggtcgacgctcaccgacgat
gaggagcgcaccgacgctgccttttccatcgcagctgccgccgcgggcttggccggcgat
gaggcccgcagtgtggcgctgctggtcgaccacggcgaacacctgcagcgtctcggcgat
tttcggggcgctgcgaagtcctatcgccaggccgccaggtcacagatcaacgcagcggcg
attcctgggagtgcgggaagttcggctctggatctcgacaccgcactcgaggccgcggag
tcgctgatgaaccgctcccgcgccctcatcgacgccactaaccactgggacctcgccgac
tggcacgacgacctcgcattcatctactactcgtcggcacgcgactcgctggcgctagcc
cacgtcgagacggcggcgaacgggtatctggccgcgggcgacggcgaggaatccgcgcgg
gcgctgttgacgggactgcaagtcagcctggactccggggacacggtgaccgcggaattc
tacgcccggcgggtcgaggagcttcttccccgcgcgcagtgggaaggccaccccgtcctg
gatgcgctggaccggctggtggagggcgaacgctag

DBGET integrated database retrieval system