KEGG   Corynebacterium lactis: CLAC_11250Help
Entry
CLAC_11250        CDS       T04042                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
clw  Corynebacterium lactis
Pathway
clw00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:clw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLAC_11250
Enzymes [BR:clw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CLAC_11250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh SPATA25
Motif
Other DBs
NCBI-ProteinID: ALA68156
UniProt: A0A0K2H364
LinkDB All DBs
Position
2490016..2491482
Genome map
AA seq 488 aa AA seqDB search
MTALLTHYIGGQWVAGEGDSLSSVSPSRPDVVVAAGRFATSAQVDQAIDAAAEAAAGWGS
LPYAERAKVLTRAAEILRANAEEWGRELSAEEGKTAPEGIGEVQRAAAILDFQATEAVRE
AGEIYHSPRAGERIEVVRKPVGVVSMITPFNFPIAIPAWKAAPALIHGNTIVWKPAHSVP
LLAVRLTQALDEAGLPAGVLNLVIAPSAEASAMQSDPRISALTFTGSTRVGRMIASRCAS
VGIPVQAELGGKNPAVVLADADLPHAATQVLNGAFNSTGQKCTATSRVAVVREVADDFLA
ELKSQLASRVTGDPLAEGVSMGPMIDARNRDEVLAAVQKHAGPDSTSGARLLVGGNIPEV
VGCEGGYFLEPTIVEVPNRDHYLWNEELFAPVLSFLVVDDAAEAFEAAEFGEYGLSAAVF
TDSLAATFNAVDRLDVGILHVNSETAGADPHVPFGGAGASGYGPKEQGRAAREFFTHTTT
VYLGRWPR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcactgctaactcattacatcggcggtcagtgggtcgccggcgagggtgactcg
ctgtcctcggtgtccccgtcccgcccggatgtcgtcgtggccgcaggccgctttgcgacg
tcggcccaggtggatcaagccatcgatgccgccgccgaggccgccgccggctgggggtcc
ctcccctacgccgagcgcgcgaaggtgctgacccgcgccgccgagattctccgagctaat
gccgaggagtggggccgcgagctctccgcggaggagggcaagacggcgcccgagggcatc
ggcgaggttcagcgcgccgcagcgatcctggacttccaggccacggaggccgtccgtgag
gccggggagatttaccactcgccgcgagccggggaacgcatcgaggttgtccgcaagccg
gtgggcgtggtgtccatgatcacgccgttcaacttccccatcgctatcccagcgtggaag
gctgcaccggcactgatccacggcaacacgattgtgtggaagcccgcgcactctgtgcct
ctccttgccgtccgcctgacccaggcgctcgacgaggcaggacttcccgctggcgtgttg
aacctggtcatcgcaccttctgccgaggcgtccgcaatgcagtccgacccgcgcatctcg
gccctgacattcaccggctccacgcgcgtcggccgcatgattgcgtcgcggtgcgcctcg
gtcggcatcccggtccaggctgagctgggtggcaagaacccggccgtcgtgcttgccgat
gccgacctgccgcatgcggcaacccaggtcctcaacggcgctttcaactccaccggacaa
aaatgcacggcgacgtcccgcgtggcggtcgtgcgcgaggtggccgacgacttcctcgct
gagctgaaaagccagctggccagtcgcgtcaccggcgacccgctggccgagggcgtgtcc
atgggcccgatgattgacgcccgcaaccgcgacgaggtgctggccgcggtccaaaagcac
gcgggcccggactccacctcgggcgcgaggcttctggtgggtggcaatatcccggaggtc
gtcggctgcgagggcggctacttcctggagccgaccatcgtggaggttccgaaccgcgac
cactacctgtggaacgaggaactcttcgcgcccgtgcttagcttcctggttgtcgacgac
gccgcggaggccttcgaggccgcggagttcggcgagtacggcctgtccgccgcggtgttc
accgactccctggccgcgacgttcaacgccgtcgaccgcctggacgtcggcatcctgcac
gtcaattccgagaccgcgggcgccgacccccacgtgcccttcggcggcgcaggggcctcc
ggctacggcccgaaggagcagggccgggccgctcgggaattcttcacgcacaccacgacc
gtctacttaggaaggtggccacgatga

DBGET integrated database retrieval system