KEGG   Campylobacter lanienae: CLAN_0692Help
Entry
CLAN_0692         CDS       T05075                                 

Gene name
aroG
Definition
(GenBank) 2-dehydro-3-deoxyphosphoheptonate aldolase (DAHP synthetase, class II)
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
clx  Campylobacter lanienae
Pathway
clx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
clx01100  Metabolic pathways
clx01110  Biosynthesis of secondary metabolites
clx01130  Biosynthesis of antibiotics
clx01230  Biosynthesis of amino acids
clx02024  Quorum sensing
Module
clx_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:clx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLAN_0692 (aroG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLAN_0692 (aroG)
Enzymes [BR:clx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     CLAN_0692 (aroG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2 Tsi6
Motif
Other DBs
NCBI-ProteinID: ARQ97439
UniProt: A0A1X9SMJ1
LinkDB All DBs
Position
complement(685837..687186)
Genome map
AA seq 449 aa AA seqDB search
MSKWNKDSWRDYNILQQPVYPDTNKLREFEDKLSKLPPLVFAGEVRNLKDELAKVTQGHG
FLLQGGDCAESFANFNAVNIRDMFKIILQMAIVLTFAGGCPVVKVGRVAGQFAKPRSSDY
EEINGVKLPSYRGDIINGFEFNESARVPDPKRMIDAYYQSASTLNLLRAFSRGGLANLHE
VHRWNLGFVKRSELDEKFEKLASELTNALKFMEACGVTTSNTPTLSETKLYTSHEALLLP
YEEALTRVDSLSGDWYDCSAHMLWIGERTRGVDDAHVHFLSGVKNPIGCKIGPNATADDV
IKLANKLNPNNENGRLNIIIRMGADKIESRLPNILKDIKSEGLNILWSIDPMHGNTVKAS
NGYKTREFDNVLREVKSFFDIHHACGTIPGGVHLEMTGQDVTECTGGAFKVTQEALASRY
ETQCDPRLNADQALELAFLIADEVKKSRS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatggaataaagatagttggagagattataatattttacaacaaccggtgtat
cctgatactaacaagcttagagagttcgaagataagcttagcaaactcccaccacttgta
tttgcaggtgaggttagaaatctcaaagatgagctagctaaggtcactcaaggccatggc
tttttacttcaaggtggagattgcgctgagagttttgctaactttaatgcggtaaatatc
cgtgatatgtttaagattatattacaaatggcgattgtccttaccttcgctggtggctgt
cctgtagtcaaggtcggtcgtgtagcgggtcaatttgccaaacctagaagtagcgattat
gaagagataaatggggttaagctccctagctatagaggcgatatcataaatggatttgaa
tttaatgaatcagctagagtcccagatcctaaaagaatgatagatgcctactatcaaagc
gcatctacgctaaatcttctaagggcattttcacgaggtggattggctaatttacacgaa
gttcatagatggaatttaggatttgtaaagcgaagtgaattagatgaaaaattcgaaaaa
ctcgcttctgagcttacaaatgctcttaaatttatggaggcttgtggggttacaacttct
aataccccaacactaagtgaaaccaaattatacacttctcacgaagcacttttacttcca
tacgaagaggctcttacaagggttgatagtttaagcggagattggtatgactgctctgct
cacatgctttggataggtgagagaactagaggagttgatgatgctcatgtccatttctta
agcggagttaaaaatccaatcggatgcaaaatcggcccaaatgccacagccgatgatgtg
ataaaattagccaacaaactaaacccaaataacgaaaatggccgcctaaatatcatcatc
agaatgggagctgataagatagagagtcgcttgccaaatatcttaaaagatattaaatcc
gaaggcctaaatatcttatggagtattgatcctatgcatggcaacacggtaaaagcgtca
aatggatataagactcgtgaatttgataatgttttaagagaggttaagagcttctttgat
atccatcacgcttgtggcaccatacctgggggcgtccatttagagatgacaggtcaagat
gttacagagtgtactggtggagcatttaaggtaactcaagaggctcttgctagtcgttat
gagactcaatgcgacccaaggctaaatgccgatcaagccttagagcttgccttcttaatc
gcagatgaagtgaaaaaatctcgctcataa

DBGET integrated database retrieval system