KEGG   Cellulophaga lytica DSM 7489: Celly_0531Help
Entry
Celly_0531        CDS       T01434                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cly  Cellulophaga lytica DSM 7489
Brite
Translation factors [BR:cly03012]
 Eukaryotic Type
  Elongation factors
   Celly_0531
 Prokaryotic Type
   Celly_0531
Mitochondrial biogenesis [BR:cly03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Celly_0531
Exosome [BR:cly04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Celly_0531
  Exosomal proteins of breast cancer cells
   Celly_0531
  Exosomal proteins of colorectal cancer cells
   Celly_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase AAA_29
Motif
Other DBs
NCBI-ProteinID: ADY28366
UniProt: F0RA37
LinkDB All DBs
Position
complement(587997..589184)
Genome map
AA seq 395 aa AA seqDB search
MAKETFDRSKPHLNIGTIGHVDHGKTTLTAAITTVLANAGLSELRSFDSIDNAPEEKERG
ITINTSHVEYSTANRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGIPRIVVFLNKVDMVDDEELLELVEMEVRELLSFYEYDGDNGPVVSGSALGALN
GEQKWVDTVMELMEAVDNWIELPKRDVDKDFLMPVEDVFTITGRGTVATGRIETGVANTG
DAVDIIGMGAEKLASTITGVEMFRKILDRGEAGDNVGILLRGIEKSQISRGMVICKPGSV
KPHSKFEAEVYILKKEEGGRHTPFHNNYRPQFYVRTTDVTGTISLPSGVEMVMPGDNLTI
TVELLSPIALSEGLRFAIREGGRTVGAGQVTKIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaacttttgatcgttccaaaccgcacttaaatataggtactattggacac
gtagatcacggtaaaactactttaactgctgctattacaacagtattggcaaatgcaggt
ctttctgaattaagaagtttcgattctatcgataacgctccagaagaaaaagaaagaggt
ataacaattaatacttctcacgtagagtattcaactgcaaaccgtcactatgcacacgta
gattgtccaggtcacgcggattacgttaagaacatggtaactggtgctgctcagatggat
ggtgctattttggtagttgctgcaactgatggtccaatgcctcaaacacgtgagcacatc
ttattaggtcgtcaggtaggtattccaagaatcgttgttttcttaaacaaggttgatatg
gttgatgatgaagagcttttagagcttgttgaaatggaagttagagaattactttctttt
tacgagtatgatggtgataatggtcctgttgtttctggttctgctttaggtgcacttaat
ggtgagcaaaaatgggtagatacagtaatggaattgatggaggctgttgataactggatc
gaattaccaaagcgtgatgtagataaggatttcttaatgcctgtagaggatgtatttaca
attacaggtcgtggaacagttgcaactggtcgtattgaaactggtgttgctaatacaggt
gatgctgttgatatcattggtatgggtgctgagaaattagcttctactattactggtgtt
gaaatgttccgtaagatattagatagaggtgaagctggtgataacgtaggtatcttatta
agaggtattgaaaagtctcaaatcagtagaggtatggtaatctgtaagccaggttctgtt
aagccacactctaagtttgaagctgaggtttatatcttgaaaaaagaagaaggtggtcgt
cacacaccattccataataactaccgtccacagttttacgtaagaacaacggatgtaaca
ggaactattagtcttccttcaggagttgaaatggttatgcctggtgataacttaactatt
acagtagaattattatctcctattgcacttagtgaaggtttacgttttgcaatccgtgag
ggtggtagaacagtaggtgctggtcaggtaactaagatcatagaatag

DBGET integrated database retrieval system