KEGG   Cellulophaga lytica DSM 7489: Celly_0597Help
Entry
Celly_0597        CDS       T01434                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00380  Tryptophan metabolism
cly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Celly_0597
Enzymes [BR:cly01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Celly_0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADY28432
UniProt: F0RAN9
LinkDB All DBs
Position
complement(656254..657528)
Genome map
AA seq 424 aa AA seqDB search
MQFKNTLEFAKELDVNDALKGYRDQFYFPKINGKDAIYFTGNSLGLQPKTAQKFVDDVMQ
DWAQLGVEGHFYAEKSWWDYHERLAAPMATLLGAKTKEVCVMNTLTVNLHFLMASFYRPT
AKRFKIICEEKAFPSDQYMLTSQVKFHGFNPKDTIVEVKKREGEHFWRTEDVVAKINEVG
DELALVLIGGVNYYNGQVFDMKTITKAGQDVGAFVGWDLAHAAGNIELKLNEWNADFASW
CSYKYINSGPGNASGIYVNEKHLADDSIPRLEGWWGSKKETRFLMKPEFESSHTADSWQV
SNPPVLSMAPYLASLEMFAEVGMPALIKKRNVIVAYLEFVLQEIDKEVETANFEIITPKE
RGTQLSVLLHGQGKELFNYLMKNGVITDWREPNVIRLAPAPFYCSFEDMYRFGQILKEGI
LQSN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttaaaaatactttagagtttgccaaagaattagatgttaatgatgctttaaaa
ggatatagagatcagttttattttcctaaaattaatggtaaagatgctatttattttaca
ggaaattctcttgggttacagccaaaaacagcacaaaaatttgtagatgatgtaatgcaa
gattgggcacaacttggagtagaagggcatttttatgcagaaaaatcatggtgggattat
catgagcgtttagcagcgccaatggctacattattaggagcaaaaactaaagaagtttgt
gtaatgaatacattaactgtaaatcttcattttttaatggcttcattttacagacctacc
gctaaaaggtttaaaattatttgcgaagaaaaagcatttccatcagaccaatatatgtta
accagtcaggttaaatttcacggttttaaccctaaagacactatagttgaggttaaaaaa
cgagaaggagaacatttttggcgtacagaagatgttgtggctaaaattaacgaagtagga
gatgagcttgcacttgtattaattggtggtgtaaactattacaacggacaagtttttgat
atgaaaacgataacaaaagcagggcaagatgttggtgcttttgtaggttgggacttagca
cacgcagcaggtaatatagaacttaaattaaatgagtggaatgcagattttgcatcatgg
tgtagttacaaatatataaatagtggcccgggcaatgcatctggtatttatgttaatgaa
aaacatttggcagatgatagcatacctaggctagaaggttggtggggatctaaaaaagaa
acacgttttttaatgaagccagaatttgagtctagccacactgcagactcttggcaagta
agtaatccaccagttttgtcaatggctccttatttagcatctttagaaatgtttgcagaa
gttggtatgccagctttaattaaaaagagaaatgtaatagtagcttacttagagtttgtt
ttgcaagaaatagataaagaagtagaaacagccaattttgagattattacaccaaaagaa
agaggtacacaattgtctgtattgttacacgggcaaggaaaagagttgtttaattattta
atgaaaaacggagtaataacagattggagagagccaaacgtaatacgtttagctcctgca
ccattttactgttcttttgaagatatgtaccgttttggacaaattttaaaagagggtatt
ttacaaagtaattaa

DBGET integrated database retrieval system