KEGG   Cellulophaga lytica DSM 7489: Celly_0790Help
Entry
Celly_0790        CDS       T01434                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00564  Glycerophospholipid metabolism
cly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cly00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Celly_0790
Enzymes [BR:cly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Celly_0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 HI0933_like NAD_binding_8 FAD_binding_3 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADY28622
UniProt: F0RCE5
LinkDB All DBs
Position
906188..907768
Genome map
AA seq 526 aa AA seqDB search
MTKNIFNREALIAQLQQEKNWDVLIIGGGASGLGAALDSATRGYKTVLFEQIDYAKGTSS
RSTKLVHGGVRYLAQGNVDLVREALHERGLLAKNAPHLVSNLSFIIPNYKWWGTPFYTIG
LKVYDILSGRLSFGKSFSLSRKKTIQKLKTIKTDGLKGGVLYHDGQFDDSRLAVNIAQTA
IEKGATLLNYFKVIKLTKDTNGNTNGVVVLDTETNTEYTVFAKTIINATGVFTDEILKMD
DAASKNLVRPSQGIHLVVDRSFLPGNEAIMIPKTTDGRVLFLVPWHNRVILGTTDTLIDS
HSLEPKPLEEEIDFILANANEYLNKNVSRKDVLSMYSGLRPLAAPKDKSEKTKEISRSHK
VLVSNSKLITITGGKWTTYRRMAQDTINKAIEVGQLAKKECVTEDLQLHGAVANNDIINH
LSFYGSDEASILEMVQHDPSLGEKLHPNLEFVKAEVVWAVKNEMARTIEDILARRVRVLF
LDAKAAIEIAPLVADIIAKELNKDNAWKQNQIENFTKVAEVYVLKH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaaacatatttaacagagaagcattaatagcacaattacaacaggaaaaaaac
tgggatgtattaattattggcggtggtgcttctggtttaggagctgcactagatagtgct
actagagggtacaaaacagtattgtttgaacagatagattatgcaaaaggaactagtagc
cgtagtacaaaactagtacacggtggggtacgttatttggctcagggcaatgtagatttg
gtaagagaagctttgcatgaaagaggattattagctaaaaatgcaccgcatttggttagc
aatctctcatttataattccaaattacaaatggtggggaactccattttacaccattggc
ttaaaagtgtatgatattttatctggtagactaagttttggaaaatcgttttcactttct
agaaaaaaaactattcagaaattaaaaacaataaagacagacggactaaaaggtggtgtt
ttataccatgatggtcagtttgacgattctagacttgctgttaatatagcacaaacagct
attgaaaaaggcgcaacacttttaaattattttaaagttataaagcttacaaaagacact
aatggcaataccaatggtgtggtagttttagacacagaaacaaatacagagtatactgtt
tttgctaaaacaataataaatgctacaggtgtttttactgatgaaatattaaaaatggat
gatgctgcttccaaaaaccttgtacgtccaagtcaaggtattcacttagttgtagacagg
tcatttttaccaggtaatgaagccataatgataccaaaaactacagatggtagggtatta
tttttagtgccttggcacaacagagtaattttaggaacaacagacacccttatagacagc
catagtttagagcctaaacctttagaagaagaaatagattttatactagcaaatgccaac
gagtatttaaacaaaaatgttagtcgtaaagacgtattaagtatgtactctggattacgt
cctttagctgcaccaaaagataaatctgaaaaaacaaaagaaatatctagaagtcataaa
gttttagtttctaactctaaattaattacaattactggcggtaaatggacaacctataga
agaatggcacaagacaccataaacaaagctatagaagtaggacagcttgccaaaaaggaa
tgtgttacagaagatcttcaattgcatggcgcggttgccaacaatgatataattaatcat
ttatccttttatgggtctgatgaagccagtattttagaaatggtacaacatgacccaagt
ttaggtgaaaaattgcatcctaatttagagtttgtaaaagccgaagtagtttgggcagtt
aaaaatgaaatggcaagaaccattgaagatattttagctaggcgtgtacgagtattattt
ttagacgccaaagccgcaatagaaatagcaccattagttgcagatattatagctaaggaa
ctaaataaagataatgcctggaaacaaaatcaaattgaaaactttacaaaagttgctgaa
gtttatgttttaaaacattaa

DBGET integrated database retrieval system