KEGG   Cellulophaga lytica DSM 7489: Celly_1184Help
Entry
Celly_1184        CDS       T01434                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00240  Pyrimidine metabolism
cly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cly00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Celly_1184
Enzymes [BR:cly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Celly_1184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ADY29012
UniProt: F0RG46
LinkDB All DBs
Position
complement(1323435..1324079)
Genome map
AA seq 214 aa AA seqDB search
MFLENTVNPKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPIVDTRYHEEM
VVSHDANEIRSTPVPAAANIRLLADGCDVVGIDEAQFFDDEIVTVCNDLANKGIRVLVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAICTRTGNLANYSFRKSNNDNLVMLGETEEYEP
LSRAAYYKAMLKEKVKTIDVDAEQIKDPKKDSNA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacggttaaccccaaagaacaatttggctggatagaggttatttgc
ggatctatgttctctggtaagacagaagaattaattagaagacttaaacgtgcgcagttt
gcaaagcaaaaagttgaaatttttaagcctattgtagatacgcgctaccatgaagaaatg
gtagtgtctcatgatgctaatgaaataaggtctacgcctgtgcctgctgctgcaaatata
cggttgttggcagatggttgtgatgttgtaggtatagatgaagctcagttttttgatgac
gaaattgttacagtttgtaatgatttagctaacaaaggcatacgtgtattggtagcaggt
ctagatatggactttaaaggaaatccatttgggccaatgccagccttaatggctacagcc
gagtatgtaactaaagtgcatgcaatttgtacacgtacgggtaacttagccaattatagt
tttagaaaatctaataatgataatttagtaatgctaggtgaaaccgaagagtatgagcca
ctaagtagagcagcatattacaaagcaatgcttaaagaaaaggtaaaaactatagacgta
gacgcagagcaaataaaagacccaaaaaaagatagtaatgcctaa

DBGET integrated database retrieval system