KEGG   Cellulophaga lytica DSM 7489: Celly_2877
Entry
Celly_2877        CDS       T01434                                 

Definition
(GenBank) hypothetical protein
  KO
K20850  iota-carrageenase [EC:3.2.1.157]
Organism
cly  Cellulophaga lytica DSM 7489
Brite
KEGG Orthology (KO) [BR:cly00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Celly_2877
Enzymes [BR:cly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.157  iota-carrageenase
     Celly_2877
SSDB
Motif
Pfam: Pectate_lyase_3
Other DBs
NCBI-ProteinID: ADY30694
UniProt: F0RBP4
LinkDB
Position
complement(3296269..3297744)
AA seq 491 aa
MRVQLKHFYVASMALFAIGCSKEVEENENSEILETPTELRVSDGRFYTPPTNAVISNVKN
LVTDFNVNNRDTNDDSAKLNNAIASLASSGGKLVIPRGKYYLNKIRMRSNVHLEIENGAT
IYPTRGIAANSNHRIFDFASKTGDKIENVSIIGKGGKFIVDLRGNSSKNLIVADLGNVEN
FKLSNITIKDEKTVFASILVSFTGKPGNAWPHKGIVQNINQTNAHTGYGLIQAYAADNIL
FKNLKCKGGVTLRLETDNLAMKAANRGGVRDIFATKISNTSGLTPVMFSPHFMENGKVTI
DDVTAIGCAYAVRVEHGFIEIFDKQNRASSEAFKNYIEGILGVGSVEIVYRRNNGRTWAA
RIANDFSEIAYNHSNPAVNGIKPGSFKNSTVKNVKVTYKNTGAKLKQAFLPYLPCSEWSK
LCKPGPSGFEYNGPSLGVTIDNTKRDNSLGNYNVNVSTSNVQGFPSNHILRVKHNTAKIC
NKGVGTINSCN
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgagagtacaattaaaacatttttacgttgcatctatggctttatttgctattggatgt
tctaaggaagttgaagaaaatgaaaattcagaaattctagaaacaccaacagagttaagg
gtttcagatggtaggttctacacaccacctacaaatgcagtgatatctaatgttaaaaat
ttggttacagattttaatgtaaataacagagatactaatgatgatagtgcaaaattaaat
aacgcaatagcaagtttagcttctagtggaggaaaattagttattcctagaggcaagtat
tacttaaataaaattagaatgcgatctaatgtccatttagaaattgaaaatggagctaca
atatatcctactagaggcattgctgctaatagcaatcatagaatttttgattttgccagc
aaaacaggagataaaatagaaaacgtaagtattattggtaaagggggaaagtttattgtg
gatctaagaggtaattcttctaaaaacttaatagttgctgatttaggaaatgtagaaaac
tttaaactatctaatattactattaaagatgaaaaaacagtttttgcatctattttagta
agttttacagggaaacctggtaatgcttggccgcataaaggtatagttcaaaatataaat
cagacaaatgcacatactggttatggattaatacaggcttatgctgcagataatatttta
tttaaaaaccttaaatgtaaaggaggagtaacactacgtttagagacagataacttggca
atgaaagctgctaacagaggtggtgtaagagatatttttgctacaaaaattagtaacact
agtggtttaacaccagtaatgttttctcctcattttatggaaaacggaaaagtaaccata
gatgatgttaccgctattggttgtgcttacgctgtacgtgtagaacacggttttatagag
atttttgataagcaaaatagagctagcagtgaagcttttaaaaactatatagagggtatt
ttgggtgtaggttctgtagaaattgtatacaggcgaaataatggaagaacttgggctgca
agaatagctaatgattttagtgaaatagcatacaaccactctaacccagctgtaaatggt
attaagccaggaagttttaaaaactctactgtaaaaaatgtaaaagtaacttacaaaaat
acaggagctaagctaaagcaagcctttttaccatatttgccttgctcagaatggtctaaa
ttgtgtaaaccaggaccttctggttttgagtataacggtccgtctttaggcgttaccata
gataatactaaaagagataatagtcttggaaactacaatgtaaacgtaagtacatctaat
gtacaaggttttcctagcaaccacatattacgtgttaagcataatacggctaaaatttgt
aacaaaggtgttggcactattaattcttgtaactaa

DBGET integrated database retrieval system