KEGG   Chlorobaculum limnaeum: BIU88_06355Help
Entry
BIU88_06355       CDS       T04492                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
clz  Chlorobaculum limnaeum
Brite
Enzymes [BR:clz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BIU88_06355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4427
Motif
Other DBs
NCBI-ProteinID: AOS83805
UniProt: A0A1D8D2K4
LinkDB All DBs
Position
1438356..1438958
Genome map
AA seq 200 aa AA seqDB search
MSYQQPALPYADNALEPHISANTIGFHYGKHHATYVKNYNALVEGTPFDAMSLEEVIVQT
ASDASKVGVFNNGAQAWNHTFYWNGLTPNGGGEPTGEIAAKIAEDFGSVDKFKEELKNAA
ATQFGSGWAWLVLDNGTLKVTKTGNAQNPITSGQTPLLCIDVWEHAYYLDYQNRRPDHVA
AVIENLINWDFVNANYAAAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatcagcaaccagcactcccgtacgccgacaacgcgctcgaaccgcacatttcg
gccaataccatcggatttcactacggcaagcaccatgcaacctacgtcaagaactacaac
gccctggttgaaggtacgccattcgacgccatgagcctcgaagaggttattgttcagacc
gccagcgacgcctccaaggttggcgtattcaacaacggcgcgcaggcatggaaccacaca
ttctactggaacggcctcaccccgaacggcggcggcgaaccgaccggcgaaatcgccgca
aagatcgccgaagatttcggcagcgtggacaagttcaaggaggagttgaagaacgccgcc
gcaacccagttcggcagcggctgggcctggctggttctcgacaacggcacgctcaaggtg
accaaaaccggcaacgcccagaacccgataacctccggccagacccctctgctttgcatc
gacgtctgggagcacgcctactacctcgactaccagaaccgccgccccgaccacgtggcc
gccgtaatcgaaaacctgatcaactgggatttcgtgaacgcaaactatgccgccgcaaaa
taa

DBGET integrated database retrieval system