KEGG   Caldivirga maquilingensis: Cmaq_0173Help
Entry
Cmaq_0173         CDS       T00611                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
cma  Caldivirga maquilingensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N Glu_dehyd_C Methyltransf_25 ThiF AlaDh_PNT_C Sacchrp_dh_NADP ADH_N_assoc Methyltransf_11 Shikimate_DH FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABW01022
UniProt: A8MA90
LinkDB All DBs
Position
205387..206400
Genome map
AA seq 337 aa AA seqDB search
MRALVWTAVGRMEIKDVPKPIPQPGWVVMRVKYTGVCGSDIGGFLGKNELRRPPLIMGHE
FTGIVEEAGPGVPKEYIGRLFTVNPIIGCGHCRYCRSGLKNLCVMRKIIGIDYPGAYAEY
VAVPVDNLYPVSDPVKGALAEPLATSLRAVRLSGVSLGDSVLVIGAGPVGSLAIKLLNIG
GIKDITAIDINANRLEWARRWGASKTLSTTGEEALKTIRELYPEGFDAVIDAVGSTDTRR
LAINTVRRGGRVVFVGLHDNETSIPGNLIVRGEIEIKGSFSYTDEDFRRAVNIIESGLLD
PREGWVDIRPLEKGQETFTELAGTETKYVKIMLTPGE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagggctcttgtttggaccgcagtaggtaggatggagattaaggatgttcctaagcca
attcctcaacctggctgggtcgttatgagggttaagtacactggtgtatgcggctcagac
ataggtggattcctaggtaagaatgaacttcgtaggccaccgttaataatgggtcatgaa
ttcaccggtattgttgaggaggctggaccaggggttcctaaggaatacattggtaggctc
ttcaccgtcaacccaataattggatgcggtcactgtaggtattgtaggagcgggttaaag
aacctgtgcgtaatgaggaagataataggcattgattaccctggagcttacgctgaatac
gtcgcagtacctgtggataacctataccctgtaagtgacccagttaagggtgccttagcc
gaaccattagccacatcattaagggccgttaggttatctggagtcagcctgggtgattca
gtactggttattggcgctggcccagtgggttcactggcgattaagctacttaacataggc
ggtattaaggatattactgcaattgatattaacgctaataggcttgagtgggctaggagg
tggggtgcctcaaagacacttagcaccactggggaggaggccttgaagactattagggag
ctttaccccgagggctttgatgccgttattgatgccgttgggtcaacagacaccaggaga
ctagccattaacactgtacgtaggggtggtagggttgtgttcgttggtttacacgataat
gagacttcaataccagggaacctgattgttaggggtgaaatagagattaagggatccttc
tcctacactgatgaggacttccgcagggccgtgaatataattgagtctggtttacttgac
ccaagggagggttgggttgacattaggcctcttgagaagggccaggaaacattcactgag
ttagcggggactgagacgaagtacgttaaaataatgttaaccccaggtgagtaa

DBGET integrated database retrieval system