KEGG   Caldivirga maquilingensis: Cmaq_1916Help
Entry
Cmaq_1916         CDS       T00611                                 

Definition
(GenBank) protein of unknown function DUF557
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cma  Caldivirga maquilingensis
Pathway
cma00620  Pyruvate metabolism
cma00680  Methane metabolism
cma00720  Carbon fixation pathways in prokaryotes
cma01100  Metabolic pathways
cma01120  Microbial metabolism in diverse environments
cma01200  Carbon metabolism
Module
cma_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cmaq_1916
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cmaq_1916
   00680 Methane metabolism
    Cmaq_1916
Enzymes [BR:cma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cmaq_1916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 Peptidase_M30
Motif
Other DBs
NCBI-ProteinID: ABW02733
UniProt: A8MBK0
LinkDB All DBs
Position
complement(1992749..1994287)
Genome map
AA seq 512 aa AA seqDB search
MRIIPRTMCTQHPDYANVPQWVVNDFIKGDDEVYEAYMNYSIYDCQETMWDFEGKDVDIY
VVRKLLENYGGFFINKVLGEDIYLTYRLPNPNVEASDRKIFAEALETIPMAYDLARVFYG
KPVKAIFEVIFPLTSSSRDLIMTLRYYERIVAGKCSVELDDGLKVSDVIGEVEPKTIEVI
PLVEDMESLVRIDSIIEGYVKVAKPQYLRVFIARSDPAMNYGLIPAVLLAKIALSRVYAI
GNSLGLSIYPIIGVGPTPFRGNFNPRNVNNTLKEYPGVYTFTVQSAFRYDYPVDNAKDAI
NLINNSKPTEPVILSSDEEELALTIIRQYTDRYQAEVEGLANAVNYIAQLLPPRRTRRLH
IGLFGYGRGFRGVTLPRAIAFVGALYSIGIPPEILGLSTLLKLNERQWGVLEGNYVNLWS
DLSDAAQYICMECIEQLPSMKSELRVSKETIAMVLEDIKAIDELGVKVSSPGFEQRKHAL
LTKLFLESVNNSYINDAKAYLLDMAKVRRAIG
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaggattataccgaggacaatgtgtacgcagcaccctgactacgccaatgtgcctcaa
tgggttgttaacgacttcattaagggtgatgatgaggtttatgaagcctacatgaattac
agtatttacgattgtcaggaaaccatgtgggacttcgagggtaaggacgtggatatttac
gtggttaggaagctccttgagaattacgggggattcttcattaataaggtgcttggggag
gatatttacctaacctacaggttacctaaccctaatgttgaggcctctgataggaagatt
ttcgctgaggcccttgaaacaataccaatggcctatgatttagccagggtcttctacggt
aagccagttaaggcaatatttgaagtcatcttcccattaacctccagttcaagggactta
ataatgacgctgaggtactatgaaaggattgtagcaggtaaatgcagtgttgagcttgat
gatgggcttaaggtcagtgacgttattggggaggttgagccgaagaccattgaggtgatc
ccactggttgaggatatggaatcactagtgaggattgactcaataatagagggttacgtt
aaggtggctaagccccagtaccttagggtattcatagccagatccgacccagcaatgaac
tatggcctaatcccagctgttctactggctaagatagccttatcaagggtgtacgcaatt
ggtaactcattgggtttaagcatatacccaataataggcgttggcccaacccccttcaga
ggtaatttcaacccacgtaacgtcaataacacgctcaaggagtacccgggggtgtacacg
ttcactgttcaatcagccttcaggtacgattacccggtggataatgctaaggatgctatt
aacctcattaataattcaaaacccactgaaccagtgatattgagtagtgatgaggaggaa
ttagccttaaccataattaggcagtacactgataggtatcaggctgaggttgagggatta
gcaaacgcagtaaactacattgcccaactcctacctccaaggagaactaggaggctgcac
attgggttattcggttacgggaggggtttcaggggggttacgttacctagggcgatagcc
ttcgttggagccttatactcaataggcataccccctgagatcctaggtctctcaacatta
cttaagcttaatgagagacagtggggtgtattggaggggaattacgttaacctatggagt
gacttaagcgacgctgcacaatacatatgcatggagtgtatcgagcagttaccaagtatg
aagagtgaattgagggttagtaaggagactattgcaatggttcttgaggatattaaggca
attgatgaattaggggttaaggtgtcgtcaccaggctttgaacagaggaagcatgcacta
ctcactaagctattccttgaaagcgtcaataacagttacattaatgatgctaaggcgtat
ctactggatatggctaaggtcaggagggctattgggtga

DBGET integrated database retrieval system